SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000035031 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000035031
Domain Number 1 Region: 678-803
Classification Level Classification E-value
Superfamily GAF domain-like 0.000000719
Family GAF domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000035031   Gene: ENSMMUG00000012118   Transcript: ENSMMUT00000042028
Sequence length 1147
Comment pep:known chromosome:MMUL_1:16:25210297:25301143:1 gene:ENSMMUG00000012118 transcript:ENSMMUT00000042028 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISGYQRVMKEVTEDLKIYVPDTICNRVSKMKENVKQNRKQREHIDKIKVKVANTRKQALQ
EQFDEWILDPKGMIPKTVIQNVLHEFFQNPDFKLGKHTANMKMLHLSDKQIIWKHFTANY
ISSHIKDLKSEMFEELLKHLCHSADEFREVIKADMRRQMFAELFLHCDHGKVGFLDRQRT
LALLELFYDHSSQMLRSLLRNPRQWPFIEFEEINLTELWGDMDNQKHIYEGFDEVLLEMN
TLLSAKHASKTQSKLLESPDQPKLDEQRTSTTPPNPPEQWRGVTAEQGPQRISTEEQGKK
STAEQELYTESVIEPGTHTESTLEQESSRGIVTEQETHRESTTEQGQQKGSIEGQGPRRV
SVSEQGARRESSVAEQGSRRESTAEKDRRKGSVAEQGSRRMSTAEQESLRESIIEEPYQK
SEQAPYEEIISEEQKDSTSQSRKDSILKSTKYGEPIPSEYIEVPLQEKRSWEQAYEEEVF
LSSELQEEVPTLSRKDHFSETTKKEVQKDKSCEPKSQKIEGKSWSGEFFTCNWKMKYVTF
EDEEQANLIYGNSRFAAKLHIQFPKPHPGHEVRLSSKQFQNYIELVVSELRGNEDRVLES
VVEFLMNALERSHIESLRNCARRKWLHQIQRAAETSGVSLEPVYSEAFKALTQDAEAHGN
KKISAHISLLEENLLLPEKGNVLLRNVACTLDDALFVLNRVLYRDMKGISFTVVDEGKPI
HVPQVQYHGNIFFWDQSRNKDDCNGSFLALPLQDAYMRIFGVLAVDTLRDPHEINIFLPH
EIRFYQGVANVFSTAYHYVHSREHILHIVITGIGWLFDVTSSITSITMYFVEPSPAQDSD
YVLRNMMVTGQLGLTEIHKNPPTIHRKSCIFRDFLFKCTDSSEVVLASACGETHIVVPLR
ERTGEALGVLDFNIGRNRMLLYQEYKDLQKMMKVVQVACYEILGELSGEIEKKYVLEIEK
VGEVQRAGILFFRIMLLELQESIQLLNSMEFVSLLLYDHTLLTEPNYPQDSKSIELKANM
ELVRDTLKAVILFFHPELEFSSDFGSWDKCKFYINKYLVNNICVFDPTAKHVEVNVQLID
EYIRGHSRTEVWKFGNVVIEHLYHWIHICSALTKITKKLNSSITPPLPSKTDNYMYAKMP
GEGLQDK
Download sequence
Identical sequences 9544.ENSMMUP00000015887 ENSMMUP00000015887 ENSMMUP00000035031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]