SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000035050 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000035050
Domain Number 1 Region: 1-292
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.34e-84
Family Protein kinases, catalytic subunit 0.00000253
Further Details:      
 
Domain Number 2 Region: 306-682
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.57e-72
Family Regulator of chromosome condensation RCC1 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000035050   Gene: ENSMMUG00000030250   Transcript: ENSMMUT00000042048
Sequence length 692
Comment pep:known chromosome:MMUL_1:16:23934415:23945101:1 gene:ENSMMUG00000030250 transcript:ENSMMUT00000042048 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKYERIRVVGRGAFGIVHLCLRKADQKLVIIKQIPVEQMTKEERQAAQNECQVLKLLNH
PNVIEYYENFLEDKALMIAMEYAPGGTLAEFIQKRCNSLLEEETILHFFVQILLALHHVH
THFILHRDLKTQNILLDKHRMVVKIGDFGISKILSSKSKAYTVVGTPCYISPELCEGKPY
NQKSDIWALGCVLYELASLKRAFEAANLPALVLKIMSGTFAPISDRYSPELRQLVLSLLS
LEPAQRPPLSHIMAQPLCIRALLNLHTDVGSVRMRRPEKSVAPSSTGSRTTSVRCRGISR
GPVRPAIPPPLSSVYAWGGGLGTPLRLPMLNTEVIQVAAGRTQKAGVTRSGRLILWEAPP
LGAGGGTLLPGAVEQPQPQFISRFLEGQSGVTIKHVACGDFFTACLTDRGIIMTFGSGSN
GCLGHGSLTDISQPTIVEALLGYEMVQVACGASHVLALSTERELFAWGRGDGGRLGLGTR
ESHSCPQQVPMPPGQEAQRVVCGIDSSMILTVPGQALACGSNRFNKLGLDHLSLGEEPVP
HQQMEEALSFTLLGSAPLDQEPLLSVDLGTAHSAAVTASGDCYTFGSNQHGQLGTNARRG
NRAPCKVQGLEGIKMAMVACGDAFTVAIGAEGEVYSWGKGARGRLGRRDEDAGLPRPVQL
DETHPYTVTSVSCCHGNTLLAVRPVTDEPVPP
Download sequence
Identical sequences ENSMMUP00000035051 ENSMMUP00000035050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]