SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000035061 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000035061
Domain Number 1 Region: 3-364
Classification Level Classification E-value
Superfamily Aldolase 9.32e-160
Family Class I aldolase 0.00000000000405
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000035061   Gene: ENSMMUG00000020322   Transcript: ENSMMUT00000042059
Sequence length 364
Comment pep:known chromosome:MMUL_1:16:23768683:23771113:-1 gene:ENSMMUG00000020322 transcript:ENSMMUT00000042059 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPHSYPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVENTEENRRLYR
QVLFSADDRVKKCIGGVIFFHETLYQKDDNGVPFVRTIQDKGIVVGIKVDKGVVPLAGTD
GETTTQGLDGLSERCAQYKKDGADFAKWRCVLKISERTPSALAILENANVLARYASICQQ
NGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHVYLEGTLLKPNMVTPGHAC
PIKYTPEEIAMATVTALRRTVPPAVPGVTFLSGGQSEEEASLNLNAINRCPLPRPWALTF
SYGRALQASALNAWRGQRDNAAAATEEFIKRAEVNGLAAQGKYEGSGEDGGAAAQSLYIA
NHAY
Download sequence
Identical sequences ENSMMUP00000026743 ENSMMUP00000035061 9544.ENSMMUP00000026743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]