SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000035118 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000035118
Domain Number 1 Region: 3-144
Classification Level Classification E-value
Superfamily ENTH/VHS domain 5.96e-58
Family ENTH domain 0.000000395
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000035118   Gene: ENSMMUG00000000140   Transcript: ENSMMUT00000042121
Sequence length 641
Comment pep:known chromosome:MMUL_1:16:18828143:18883663:1 gene:ENSMMUG00000000140 transcript:ENSMMUT00000042121 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTSSIRRQMKNIVNNYSEAEIKVREATSNDPWGPSSSLMTEIADLTYNVVAFSEIMSMV
WKRLNDHGKNWRHVYKALTLLDYLIKTGSERVAQQCRENIFAIQTLKDFQYIDRDGKDQG
INVREKSKQLVALLKDEERLKAERAQALKTKERMAQVATGMGSNQITFGRGSSQPNLSTS
HSEQEYGKAGGSPASYHGSPEASLCPQHRTGAPLGQSEELQPLSQRHPFLPHLGLASRPN
GDWSQPCLTCDRAARATSPRVSSELEQARPQTSGEEELQLQLALAMSREVAEQEERLRRG
DDLRLQMALEESRRDTVKIPKKKEHGSLPQQTTLLDLMDALPSSGLPAQKAEPWGPSAST
NQTNPWGRPAAPASASDPWPSFGTKPAASVDPWGVPAGASTQSVPKNSDPWAASQQPASS
AGKTASDAWGAVSSTKPVSASGSFELFSNLNGTIKDDFSEFDNLRTSKRTAESVTSLPSQ
NNGTTSPDPFESQPLTVASSKPSSARKTPESFLGPNAALVNLDSLVTRPAPPAQSLNPFL
APGAPATSAPVNPFQVNQPQPLTLNQLRGSPVLGTSTSFGPGPGVESMAVASMTSTAPHP
ALGATGSSLTPLGPATMNMVGSVGIPPSAAQATGTTNPFLL
Download sequence
Identical sequences A0A2K5WRE9 H9FRH3
ENSMMUP00000000194 ENSMMUP00000035118 XP_001098498.1.72884 XP_005583149.1.63531 XP_005583150.1.63531 XP_014974262.1.72884 9544.ENSMMUP00000000194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]