SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000035285 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000035285
Domain Number 1 Region: 211-295
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.23e-25
Family Thyroglobulin type-1 domain 0.00023
Further Details:      
 
Domain Number 2 Region: 37-118
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.62e-22
Family Growth factor receptor domain 0.0000532
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000035285   Gene: ENSMMUG00000013764   Transcript: ENSMMUT00000042284
Sequence length 297
Comment pep:known chromosome:MMUL_1:3:80573838:80582719:1 gene:ENSMMUG00000013764 transcript:ENSMMUT00000042284 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRARPTLWAAALTVLVLLRGPPVARAGASSAGLGPVVRCEPCDARALAQCAPPPAVCAE
LVREPGCGCCLTCALSEGQPCGIYTERCGSGLRCQPSPDEARPLQALLDGRGLCVNSSAV
SSLRAYLLPAPPAPGEPPAPGNASESEEDRSAGSVESPSVSSTHRVSDPKFHPVHSKIII
IKKGHAKDSQRYKVDYESQSTDTQNFSSESKRETEYGPCRREMEDTLNHLKFLNVLSPRG
VHIPNCDKKGFYKKKQCRPSKGRKRGFCWCVDKYGQPLPGYTTKGKEDVHCYSMQSK
Download sequence
Identical sequences F6U2J6
ENSMMUP00000035285 9544.ENSMMUP00000018098 ENSMMUP00000018098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]