SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000035310 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000035310
Domain Number 1 Region: 572-705
Classification Level Classification E-value
Superfamily PH domain-like 2.34e-43
Family Phosphotyrosine-binding domain (PTB) 0.000000609
Further Details:      
 
Domain Number 2 Region: 390-548
Classification Level Classification E-value
Superfamily PH domain-like 5.02e-35
Family Phosphotyrosine-binding domain (PTB) 0.019
Further Details:      
 
Domain Number 3 Region: 278-316
Classification Level Classification E-value
Superfamily WW domain 0.0000000000988
Family WW domain 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000035310   Gene: ENSMMUG00000012563   Transcript: ENSMMUT00000042311
Sequence length 755
Comment pep:known chromosome:MMUL_1:5:35846205:36047941:-1 gene:ENSMMUG00000012563 transcript:ENSMMUT00000042311 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PADSGVDTLAVFMASSGTTDVTNRNSPATPPNTLNLRSSHNELLNAEIKHTETKNSTPPK
CRKKYALTNIQAAMGLSDPAAQPLLGNGSANIKLVKNGENQLRKAAEQGQQDPNKNLSPT
AVINITSEKLEGKEPHPQDSSGCEILPSQPRRTKSFLNYYADLETSARELEQNQGNRHGI
AEEKSQPGQGQASTIIGNGDLLLQKPSKPQSSPEDGQVATVSSSPETKKDHPKTGAKTDC
ALHRIQNLAPSDEESSWTTLSQDSASPSSPDETDIWSDHSFQTDPDLPPGWKRVSDIAGT
YYWHIPTGTTQWERPVSIPADLQGSRKGSLSSVTPSPTPENEKQPWSDFAVLNGGKINSD
IWKASDLHAATVNPDPSLKEFEGATLRYASLKLRNAPHPDDDDSCSINSDPEAKCFAVRS
LGWVEMAEEDLAPGKSSVAVNNCIRQLSYCKNDIRDTVGIWGEGKDMYLILENDMLSLVD
PMDRSVLHSQPIVSIRVWGVGRDNGRDFAYVARDKDTRILKCHVFRCDTPAKAIATSLHE
ICSKIMAERKNAKALACSSLQERANANLDVPLQVDFPTPKTELVQKFHVQYLGMLPVDKP
VGMDILNSAIENLMTSSNKEDWLSVNMNVADATVTVISEKNEEEVLVECRVRFLSFMGVG
KDVHTFAFIMDTGNQRFECHVFWCEPNAGNVSEAVQAACMLRYQKCLVARPPSQKVRPPP
PPADSVTRRVTTNVKRGVLSLIDTLKQKRPVTETP
Download sequence
Identical sequences G7MST3 G7P5G9
9544.ENSMMUP00000035310 ENSMMUP00000035310 ENSMMUP00000035310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]