SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000035603 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000035603
Domain Number 1 Region: 10-126
Classification Level Classification E-value
Superfamily ENTH/VHS domain 3.01e-27
Family RPR domain (SMART 00582 ) 0.0066
Further Details:      
 
Domain Number 2 Region: 442-568
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.79e-18
Family Canonical RBD 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000035603   Gene: ENSMMUG00000001712   Transcript: ENSMMUT00000042594
Sequence length 1143
Comment pep:known chromosome:MMUL_1:3:14777472:14807672:1 gene:ENSMMUG00000001712 transcript:ENSMMUT00000042594 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFSLMDMKPPISRAKMILITKAAIKAIKLYKHVVQIVEKFIKKCKPEYKVPGLYVIDSIV
RQSRHQFGTDKDVFGPRFSKNITATFQYLYLCPSEDKSKIVRVLNLWQKNGVFKIEIIQP
LLDMAAGTSNAAPVAESVTNNEGSPPPPVKVSSEPPAQATPNSVPTVPQLPSSDAFAAVA
QLFQTTQGQQLQQILQTFQQPPKPQSPALDNAVMAQVQAITAQLKTTPTQPSEQKAAFPP
PEQKTAFDKKLLDRFDYDDEPEAVEESKKEDTTAVATTVPAAAVPPAPTATVPAAAAPAA
ASPPPPQAPFGFPGDGMQQPAYTQNMDQFQPRMMGIQQDPMHHQVPLPPNGQMPGFGLLP
TPPFPPMAQPVIPPTPPVQQPFQASFQAQNEPLTQKPHQQEMEVEQPCIQDVKRHMSDNR
KSRSRSASRSPKRRRSRSGSRSRRSRHRRSRSRSRDRRRHSPRSRSQERRDREKERERRQ
KGLPQVKPETASVCSTTLWVGQLDKRTTQQDVASLLEEFGPIESINMIPPRGCAYIVMVH
RQDAYRALQKLSRGNYKVNQKSIKIAWALNKGIKADYKQYWDVELGVTYIPWDKVKPEEL
ESFCEGGMLDSDTLNPDWKGIPKKPENEVAQNGGAETSHTEPVSPIPKPLPVPVPPIPVP
APITVPPPQVPPHQPGPPVVGTLQPPAFTPPLGIPPPGFGPGVPPPPPPPPFLRPGFNPM
HLPPGFLPPGPPPPITPPVSIPPPHTPPISIPNSTIAGINEDTTKDLSIGNPIPTVVSGA
RGNAESGDSVKMYGSAVPPAAPTNLPTXXXXXXXSFCCTQGVAPGPVIGLQAPSTGLLGA
RPGLIPLQRPPGMPPPHLQRFPLMPPRPMPPHMMHRGPPPGPGGFAMPPPHGMKGPFPPH
GPFVRPGGMPGLGGPGPGPGGPEDRDGRQQPPQQQQQQQQQPQPQPPQQQQQQQQQQQQQ
QQPPPSQQPPPTQQQPQQFRNDNRQQFNSGRDQERFGRRSFGNRVENDRERYGNRNDDRD
NSNRDRREWGRRSPDRDRHRDLEERNRRSSGHRDRERDSRDRESRREKEEARGKEKPEVT
DRAGGNKTVEPPISQVGNVDTASELEKGESEAAVLKPSEELPAEATSSVEPEKDSGSAAE
APR
Download sequence
Identical sequences 9544.ENSMMUP00000002284 ENSMMUP00000035603 ENSMMUP00000002284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]