SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000035736 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000035736
Domain Number 1 Region: 339-434
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000785
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0016
Further Details:      
 
Domain Number 2 Region: 176-229
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000157
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.058
Further Details:      
 
Domain Number 3 Region: 31-73
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000497
Family HLH, helix-loop-helix DNA-binding domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000035736   Gene: ENSMMUG00000030507   Transcript: ENSMMUT00000042727
Sequence length 512
Comment pep:known chromosome:MMUL_1:3:42275:93524:1 gene:ENSMMUG00000030507 transcript:ENSMMUT00000042727 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVESGAMIILLSPPSPKPLPPEGAKTNPSKRHRDRLNQELSRLTNLLPFPEDVRARLDK
LSVLRLIVGYLKVKDYFAGKWWLLLQSEGERPPAPAGTLVEAVATRGKGVASWPLPLAQT
WGLEQGLAVAAENLNLWLITLYIRGNTCYTQNDNKMMPELAEHLIPKEGDLLLQALNGFL
MAVTEDGYIFYVSPTVQDYLGFHQSDVIYQSVFELIHKEDRAMFQSQLRWPPDTASVSRE
ADPDTSCNIVIYSVQHLPLEDPCYLERSFVCRFRCLLDNSSGFLELNFQGHLKFLPGQNT
KSEDGTFLSPHLTLFATATPRQPLTILELQNKTFIFQTKHKLDFTPIACDSRGKVILGYT
DSELCRGGSGYQFIHAADMMYCAENHVRMMRTGESGLTVFRLLTKQGRWLWVQSNARLVF
RGGRPECIVARQRALTNLEGEEHLRKRALQLPFTFTTGEAVLYESSLPSALTALPARKRT
RARKGLPAGQDSSCPGSLLGAMMQQDESVYLS
Download sequence
Identical sequences ENSMMUP00000035736 ENSMMUP00000035736 9544.ENSMMUP00000035736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]