SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000035988 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000035988
Domain Number 1 Region: 1259-1522
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 2.33e-48
Family Galactosyltransferase LgtC 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000035988   Gene: ENSMMUG00000023321   Transcript: ENSMMUT00000042976
Sequence length 1558
Comment pep:known chromosome:MMUL_1:13:134553287:134660318:1 gene:ENSMMUG00000023321 transcript:ENSMMUT00000042976 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IGGKGDASGACAAAALPVTVFCYKMGVLIVLTVLWLFPSVKADSKAITTSLTTKWFSTPL
LLEASEFLAEDSQEKFWNFVEASQNIGSSDHHGTDYSYYHAILEAAFQFLSPLQQNLLKF
CLSLRSYSATIQAFQQIAADEPPPEGCNSFFSVHGKTTCESDTLETLLLTASERPKPLLF
KGDHRYPSSNPESPVVIFYSEIGSEEFSNFHRQLISKSNAGKINYVFRHYIFNPRKEPVY
LSGYGVELAIKSTEYKAKDDTQVKGTEVNTTVIGENDPIDEVQGFFFGKLRDLHPDLEGQ
LKELRKHLVESTNEMAPLKVWQLQDLSFQTAARILASPVELALVVMKDLSQNFPTKARAI
TKTAVSSELRTEVEENQKYFKGTLGLQPGDSALFINGLHIDLDTQDIFSLFDVLRNEARV
MEGLHRLGIEGLSLHNVLKLNIQPSEADYAVDIRSPAISWVNNLEVDSRYNSWPSSLQEL
LRPTFPGVIRQIRKNLHNMVFIVDPAHETTAELINIAEMFLSNHIPLRIGFIFVVNDSED
VDGMQDAGVAVLRAYNYVAREVDDYHAFQTLTQIYNKVRTGEKVEVEHVVSVLEKKYPYV
KVNSILGIDSAYDQNRKEARGYYEQTGVGPLPVVLFNGMPFEREQLDPDELETITMHKIL
ETTTFFQRAVYLGEVPPDQDVVEYIMNQPNVVPRINSRILTAERDYLDLTASNNFFVDDY
ARFTILDSPGKTAAVANSMNYLTKKGMSSKEIYDDSFIRPVTFWIVGDFDSPSGRQLLYD
AIKHQATKSSNNVRISMINNPAKEISYENTQISRAIWAALQTQTSNAAKNFITKMAKEGA
AEALAAGADIAEFSVGGMDFSLFKEVFESSKMDFILSHAVYCRDVLKLKKGQRAVISNGR
IIGPLEDSELFNQDDFHLLENIILKTSGQKIKSHIQQLRVEEDVASDLVMKVDALLSAQP
KGDARIEYQFFEDRHSAIKLRPKEGETYFDVVAVVDPVTREAQRLAPLLLVLAQLINMNL
RVFMNCQSKLSDMPLKSFYRYVLEPEISFTSDNSFAKGPIAKFLDMPQSPLFTLNLNTPE
SWMVESVRTPYDLDNIYLEEVDSIVAAEYELEYLLLEGHCYDITTGQPPRGLQFTLGTSA
NPVIVDTIVMANLGYFQLKANPGAWILRLRKGRSEDIYRIYSHDGTDSPPDADDVVIVLN
NFKSKIIKVKVQKKADMVNEDLLSDGTSENESGFWDSFKWGFTGGQKAEEMKQDKDDIIN
IFSVASGHLYERFLRIMMLSVLKNTKTPVKFWFLKNYLSPTFKEFIPYMANEYNFQYELV
QYKWPRWLHQQTEKQRIIWGYKILFLDVLFPLVVDKFLFVDADQIVRTDLKELRDFSLDG
APYGYTPFCDSRREMDGYRFWKSGYWASHLAGRKYHISALYVVDLKKFRKIAAGDRLRGQ
YQGLSQDPNSLSNLDQDLPNNMIHQVPIKSLPQEWLWCETWCDDASKKRAKTIDLCNNPM
TKEPKLEAAVRIVPEWQDYDQEIKQLQLRFQKEKETGTLYKEKAEEPRREGPQKHEEL
Download sequence
Identical sequences 9544.ENSMMUP00000030702 ENSMMUP00000030702 ENSMMUP00000035988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]