SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000036388 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000036388
Domain Number 1 Region: 4-66
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.00000000000000241
Family SNARE fusion complex 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000036388   Gene: ENSMMUG00000030784   Transcript: ENSMMUT00000043391
Sequence length 116
Comment pep:known chromosome:MMUL_1:13:86157057:86166409:1 gene:ENSMMUG00000030784 transcript:ENSMMUT00000043391 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGKELERCQRQANEVTEIMLNNFDKVLERDGKLAELEQRSEQLLDMSSTFSKTTKTLAQ
KKRWENIRSRVCLGLVVVGGLLIILIVLLAVFLPQSSDSSSAPRTQDAGTASGPGD
Download sequence
Identical sequences A0A096NZU9 A0A2K5UEI2 A0A2K5Z9V5 A0A2K6CNY0 F6ZVR0
ENSMMUP00000036388 ENSMMUP00000036388 NP_001252917.1.72884 XP_005575472.1.63531 XP_011712119.1.29376 XP_011821188.1.47321 9544.ENSMMUP00000036388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]