SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000036389 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000036389
Domain Number 1 Region: 8-73
Classification Level Classification E-value
Superfamily SNARE fusion complex 4.24e-21
Family SNARE fusion complex 0.0000631
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000036389   Gene: ENSMMUG00000030785   Transcript: ENSMMUT00000043392
Sequence length 100
Comment pep:known chromosome:MMUL_1:13:86149667:86154687:1 gene:ENSMMUG00000030785 transcript:ENSMMUT00000043392 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEASEGGGNDRVRNLQSEVEGVKNIMTQNVERILARGENLEHLRNKTEDLEATSEHFKT
TSQKVARKFWWKNVKMIVLICVIVFIIILFIVLFATGAFS
Download sequence
Identical sequences A0A0D9RUG9 A0A2I3MIA7 A0A2J8RP75 A0A2K5KDS9 A0A2K5LC37 A0A2K5QTY2 A0A2K5WGM6 A0A2K6CPC0 A0A2K6L0V6 A0A2K6QMY6 A0A2K6TB52 F6ZVQ1 G1QN71 G3QQI0 H2QI95 Q5REQ5 Q9BV40
ENSMMUP00000036389 ENSNLEP00000002387 GO.37990 ENSGGOP00000004846 ENSPANP00000018622 ENSGGOP00000004846 9544.ENSMMUP00000036389 9598.ENSPTRP00000020817 9600.ENSPPYP00000013636 9606.ENSP00000263864 ENSMMUP00000036389 ENSPTRP00000020817 ENSPPYP00000013636 ENSP00000263864 ENSP00000387094 gi|14043026|ref|NP_003752.2| ENSPTRP00000020817 ENSNLEP00000002387 NP_001124801.1.23681 NP_001244718.1.72884 NP_003752.2.87134 NP_003752.2.92137 XP_003268797.1.23891 XP_003309126.1.37143 XP_003942183.1.74449 XP_004029596.1.27298 XP_005575473.1.63531 XP_007968211.1.81039 XP_008967876.1.60992 XP_010380260.1.97406 XP_011712118.1.29376 XP_011819387.1.43180 XP_011919472.1.92194 XP_017373460.1.71028 XP_017711804.1.44346 ENSP00000263864

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]