SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000036425 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000036425
Domain Number 1 Region: 113-304
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.28e-34
Family Clostridium neurotoxins, the second last domain 0.028
Further Details:      
 
Domain Number 2 Region: 25-119,410-504,571-770
Classification Level Classification E-value
Superfamily ARM repeat 0.00000000165
Family Plakophilin 1 helical region 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000036425   Gene: ENSMMUG00000030795   Transcript: ENSMMUT00000043425
Sequence length 805
Comment pep:known chromosome:MMUL_1:17:14318109:14431381:1 gene:ENSMMUG00000030795 transcript:ENSMMUT00000043425 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVYFQLVGGEFDLEMNFIIQDAESITCMTELLEHCDVTCQAEIWSMFTAILRKSVRNLQT
STEVGLIEQVLLKMSAVDDMIADLLVDMLGVLASYSITVKELKLLFSMLRGESGIWPRHA
VKLLSVLNQMPQRHGPDTFFNFPGCSAAAIALPPIAKWPYQNGFTLNTWFRMDPLNNINV
DKDKPYLYCFRTSKGVGYSAHFVGNCLIVTSLKSKGKGFQHCVKYDFQPRKWYMISIVHI
YNRWRNSEIRCYVNGQLVSYGDMAWHVNTNDSYDKCFLGSSETADANRVFCGQLGAVYVF
SEALNPAQIFAIHQLGPGYKSTFKFKSESDIHLAEHHKQVLYDGKLASSIAFTYNAKATD
AQLCLESSPKENASIFVHSPHALMLQDVKAIVTHSIHSAIHSIGGIQVLFPLFAQLDNRQ
LNDSQVETTVCATLLAFLVELLKSSVAMQEQMLGGKGFLVIGYLLEKSSRVHITRAVLEQ
FLSFAKYLDGLSHGAPLLKQLCDHILFNPAIWIHTPAKVQLSLYTYLSAEFIGTATIYTT
IRRVGTVLQLMHTLKYYYWVINPADSSGITPKGLDGPRPSQKEIISLRAFMLLFLKQLIL
KDRGVKEDELQSILNYLLTMHEDENIHDVLQLLVALFLESRNSIIYVFFRVIYKLLASKS
ESIWVQALKVLGYFLKHLGHKRKVEIMHTHSLFTLLGERLMLHTNTVTVTTYNTLYEILT
EQVCTQVXHDSLTHFYSAMILKVVATLLKNSTPAELMEVRRLFLSDMIKLFSNSRENRRR
CLLQCSVWQDWMFSLGYINPKNSEE
Download sequence
Identical sequences 9544.ENSMMUP00000036425 ENSMMUP00000036425 ENSMMUP00000036425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]