SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000036746 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000036746
Domain Number 1 Region: 19-245
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 7.03e-27
Family mannose-1-phosphate guanylyl transferase 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000036746   Gene: ENSMMUG00000030936   Transcript: ENSMMUT00000043757
Sequence length 443
Comment pep:known scaffold:MMUL_1:1099214734028:3:1470:-1 gene:ENSMMUG00000030936 transcript:ENSMMUT00000043757 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLVRPDDRIELHLRHKPCALIPVYNHEAAVPAVVHTVLSSGLPCLLVDDGSSAACAAVLA
QLATLDNVSLLTLPTNQGKGAAVMAGFREAARLGFTHALQVDADGQHDMREVSTFLDASR
AHPNAVICGYPEYDDSVPKGRLYARYLTHVWVWINTLSLQIRDSMCGFRVYPLPPTLALM
DSANIGKRMDFDSDILVRLAWRNQPMRWLPTKVHYPADGLSHFRLFHDNALISSMHTRLF
FGMLVRAPMILWRRWQDTKHWADREERGSFWLMKFTAFAAKVLGRRLLSPLLYGIVFYFF
LFGRTARQSAWQYQQRLADWSQRDNLCPTHRSVFGQFMAFADALLDKLDVWNGKLRLEQI
EIIDPAQLRGQLRSERGQMLVGAHLGNLEVCRALAELGEKVTMNVLVHTKHAERFNRILG
EAGATNLRLIQVSELDPAVMMML
Download sequence
Identical sequences ENSMMUP00000036746 ENSMMUP00000036746 9544.ENSMMUP00000036746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]