SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000036790 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000036790
Domain Number 1 Region: 293-457
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.05e-43
Family SPRY domain 0.00026
Further Details:      
 
Domain Number 2 Region: 5-80
Classification Level Classification E-value
Superfamily RING/U-box 6.85e-20
Family RING finger domain, C3HC4 0.0097
Further Details:      
 
Domain Number 3 Region: 86-147
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000656
Family B-box zinc-binding domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000036790   Gene: ENSMMUG00000030952   Transcript: ENSMMUT00000043803
Sequence length 457
Comment pep:known chromosome:MMUL_1:14:88059425:88065560:1 gene:ENSMMUG00000030952 transcript:ENSMMUT00000043803 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSRILQVFQRELTCPICMNYFIDPVTIDCGHSFCRPCFYLIWQDITVLPQCSKCKKTTW
QRNLRTNIRLKNMASIARKASLRQFLSSEEQICGTHREIKKMFCEVDKSLLCLLCSNSQE
HRDHKHCPIEWAAEEHREKLLKKMLSLWEKACENHRNLNMETTRTRCWKDYVSLRREAIR
AEYQKMPAFLHDEEQHHLERLQKEGEDIFQQLNESKARMEHSRELLRGMYEDLKEMCHKA
DVELLQRTSVIKGRSPAWSIFQHPGLENKSLFHFRRNYLEQCLNKLKSSHSCQNFAVDFT
LQPERANSHIFLYGDLRSMNVGCDPQDDPHITAKSECFLVWGAKTFTSGKYYWEVHVGDS
WNWAFGVCNNYWKEKTQNDKIDGGEGLFLLGCVKEDAHSSLFTTSPLVVQYVPRPTSRVG
LFLDCEGRTMSFVDVDQNALIYTIPNCSFSPPLRPVF
Download sequence
Identical sequences 9544.ENSMMUP00000036792 ENSMMUP00000036792 ENSMMUP00000036790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]