SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000036875 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000036875
Domain Number 1 Region: 15-96
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.22e-24
Family Ubiquitin-related 0.0000137
Further Details:      
 
Domain Number 2 Region: 600-654
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000535
Family UBA domain 0.00064
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000036875
Domain Number - Region: 188-238
Classification Level Classification E-value
Superfamily ARM repeat 0.0236
Family Mo25 protein 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000036875   Gene: ENSMMUG00000021337   Transcript: ENSMMUT00000030035
Sequence length 655
Comment pep:known chromosome:MMUL_1:14:67851644:67854283:1 gene:ENSMMUG00000021337 transcript:ENSMMUT00000030035 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKGGEALPQGSPAPVQDPHLIKVTVKTPKDKEDFSVTDSCTIQQLKEEISQRFKAHPDQ
LVLIFAGKILKDPDSLAQCGVRDGLTVHLVIKMQRRAMGSECPAASVPTQGPSPGSLPQP
SSIYPADGPPAFSLGLLTGLNGLGLTYRGFPDQPSSLMRQHVSVPEFVAQLIDDPFIQGL
LSNTGLVRQLVLDNPHMQQLIQHNPEIGHILNNPEIMRQTLEFLRNPAMMQEMIRSQDRV
LSNLESIPGGYNVLRTMYTDIMDPMLNAVQEQFGGNPFATATTDNATTTTSQPSRMENCD
PLPNPWTSTHGGSGSRQQRQDGDQDAADIRNRFPNFLGIIGLYDYLQQLHENPQSLGTYL
QGTASALSQSQERPPPVNRVPPLSPSSQEPRSGQPLPKESVAIKGRSSCPAFLRYPTENG
TGKGGDQDGAGKSPTGHSTNLPDLVSGLGDSANRVPFVPLTSSPTAAIPGIPEPPWLPSP
PYPRSLRPDGMNPAPQLQDEIQPQLPLLMHLQAAMANPRAMQALRQIEQGLQVLATEAPR
LLLWFMPCLAGMGSVAGGIQSREDPLMSEDPLPNPPPEVFPALDSAELGFHSPPFLHMLQ
DLVSTNPQQLQPEAHFQVQLEQLRSMGFLNREANLQALIATGGDVDAAAEKLRQS
Download sequence
Identical sequences A0A2K6B7W3 F6ZTN5
XP_001111250.1.72884 XP_011717111.1.29376 9544.ENSMMUP00000036875 ENSMMUP00000036875 ENSMMUP00000036875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]