SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000037366 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000037366
Domain Number 1 Region: 81-327
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 1.24e-94
Family 1,3-glucuronyltransferase 0.000000000523
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000037366   Gene: ENSMMUG00000031126   Transcript: ENSMMUT00000044350
Sequence length 328
Comment pep:known chromosome:MMUL_1:14:11469487:11476498:1 gene:ENSMMUG00000031126 transcript:ENSMMUT00000044350 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLGRGRRRGHEAEAEERVSRLLPGVDRRPPLRAGQPCDCLPPLRAAAEQLRQKDLRISQL
QAELRRPPPAPAQPPEPEALPTIYVVTPTYARVVQKAELVRLSQTLSLVPRLHWLLVEDA
ESPTPLVSGLLAASGLLFTHLVVLTPKAQRLREGEPGWVHPRGVEQRNKALDWLRGRGGA
VVVYFADDDNTYSRELFEEMRWTRGVSVWPVGLVGGLRFEGPQVQDGRVVGFHTAWEPNR
PFPVDMAGFAVALPLLLAKPNAQFDSTAPRGHLESSLLSHLVDPKDLEPRAANCTRVLVW
HTRTEKPKMKQEEQLQRQGRGSDPAIEV
Download sequence
Identical sequences ENSMMUP00000037366 9544.ENSMMUP00000037366 ENSMMUP00000037366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]