SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000037428 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000037428
Domain Number 1 Region: 128-394
Classification Level Classification E-value
Superfamily vWA-like 5.72e-90
Family Trunk domain of Sec23/24 0.000000651
Further Details:      
 
Domain Number 2 Region: 8-66,411-519
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 3.4e-64
Family beta-sandwich domain of Sec23/24 0.00038
Further Details:      
 
Domain Number 3 Region: 623-762
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 9.15e-54
Family C-terminal, gelsolin-like domain of Sec23/24 0.00000701
Further Details:      
 
Domain Number 4 Region: 520-622
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 6.8e-46
Family Helical domain of Sec23/24 0.00000791
Further Details:      
 
Domain Number 5 Region: 49-123
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 4.58e-21
Family Zn-finger domain of Sec23/24 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000037428   Gene: ENSMMUG00000012878   Transcript: ENSMMUT00000044413
Sequence length 766
Comment pep:known chromosome:MMUL_1:10:51842896:51892978:1 gene:ENSMMUG00000012878 transcript:ENSMMUT00000044413 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATYLEFIQQNEERDGVRFSWNVWPSSRLEATRMVVPLACLLTPLKERPDLPPVQYEPVL
CSRPTCKAVLNPLCQVDYRAKLWACNFCFQRNQFPPAYGGISEVNQPAELMPQFSTIEYM
IQRGAQSPLIFLYVVDTCLEEDDLQALKESLQMSLSLLPPDALVGLITFGRMVQVHELSC
EGISKSYVFRGTKDLTAKQIQDMLGLTKPAMPMQQARPVQPQEHPFASTRFLQPVHKIDM
NLTDLLGELQRDPWPVTQGKRPLRSTGVALSIAVGLLEGTFPNTGARIMLFTGGPPTQGP
GMVVGDELKIPIRSWHDIEKDNARFMKKATKHYEMLANRTAANGHCIDIYACALDQTGLL
EMKCCANLTGGYMVMGDSFNTSLFKQTFQRIFTKDFNGDFRMAFGATLDVKTSRELKIAG
AIGPCVSLNVKGPCVSENELGVGGTSQWKICGLDPTSTLGIYFEVVNQHNAPIPQGGRGA
IQFVTHYQHSSTQRRIRVTTIARNWADVQSQLRHIEAAFDQEAAAVLMARLGVFRAESEE
GPDVLRWLDRQLIRLCQKFGQYNKEDPTSFRLSDSFSLYPQFMFHLRRSPFLQVFNNSPD
ESSYYRHHFARQDLTQSLIMIQPILYSYSFHGPPEPVLLDSSSILADRILLMDTFFQIVI
YLGETIAQWRKAGYQDMPEYENFKHLQAPLDDAQEILQARFPMPRYINTEHGGSQARFLL
SKVNPSQTHNNLYAWGQETGAPILTDDVSLQVFMDHLKKLAVSSAC
Download sequence
Identical sequences 9544.ENSMMUP00000037433 ENSMMUP00000037433 ENSMMUP00000037428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]