SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000037521 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000037521
Domain Number 1 Region: 265-447
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.88e-26
Family SPRY domain 0.017
Further Details:      
 
Domain Number 2 Region: 475-645
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000124
Family Nucleotide and nucleoside kinases 0.02
Further Details:      
 
Domain Number 3 Region: 7-45
Classification Level Classification E-value
Superfamily SAP domain 0.00000000586
Family SAP domain 0.0012
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000037521
Domain Number - Region: 161-280
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0288
Family beta-sandwich domain of Sec23/24 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000037521   Gene: ENSMMUG00000021098   Transcript: ENSMMUT00000044504
Sequence length 765
Comment pep:known chromosome:MMUL_1:1:212201873:212209742:1 gene:ENSMMUG00000021098 transcript:ENSMMUT00000044504 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSSPVNVKKLKVSELKEELKKRRLSDKGLKAELMERLQAALDDEEAGGRPAMEPGNGSL
DLGGDSAGRSGAGLEQEAAVGGDEEEEEEEEEEEGISALDGDQMELGEENGAAGAADSGP
MEEEEAASEDENGDDQGFQEGEDELGDEEEGAGDENGHGEQQPQPPATQQQQTQQQRGAA
KEAAGKSSGPTSLFAVTVAPPGARQGQQQAGGDGKTEQKGGDKKRGVKRPREDHGRGYFE
YIEENKYSRAKSPQPPVEEEDEHFDDTVVCLDTYNCDLHFKISRDRLSASSLTMESFAFL
WAGGRASYGVSKGKVCFEMKVTEKIPVRHLYTKDIDIHEVRIGWSLTTSGMLLGEEEFSY
GYSLKGIKTCNCETEDYGEKFDENDVITCFANFESDEVELSYAKNGQDLGIAFKISKEVL
AGRPLFPHVLCHNCAVEFNFGQKEKPYFPIPEEYTFIQNVPLEDRVRGPKGPEEKKDCEV
VMMIGLPGAGKTTWVTKHAAENPGKYNILGTNTIMDKMMVAGFKKQMADTGKLNTLLQRA
PQCLGKFIEIAARKKRNFILDQTNVSAAAQRRKMCLFAGFQRKAVVVCPKDEDYKQRTQK
KAEVEGKDLPEHAVLKMKGNFTLPEVAECFDEITYVELQKEEAQKLLEQYKEESKKALPP
EKKQNTGSKKSNKNKSGKNQFNRGGGHRGRGGFNMRGGNFRGGAPGNRGGYNRRGNMPQR
GGGGGGSGGIGYPYPRAPVFPGRGSYSNRGNYNRGGMPNRGNYNQ
Download sequence
Identical sequences ENSMMUP00000027771 ENSMMUP00000037521 9544.ENSMMUP00000027771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]