SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000037967 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000037967
Domain Number 1 Region: 3-115
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.44e-23
Family Chaperone J-domain 0.0000406
Further Details:      
 
Domain Number 2 Region: 242-323
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 2.49e-20
Family HSP40/DnaJ peptide-binding domain 0.0004
Further Details:      
 
Domain Number 3 Region: 162-239
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 0.000000000144
Family HSP40/DnaJ peptide-binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000037967   Gene: ENSMMUG00000002766   Transcript: ENSMMUT00000044949
Sequence length 335
Comment pep:known chromosome:MMUL_1:12:55629889:55630904:-1 gene:ENSMMUG00000002766 transcript:ENSMMUT00000044949 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TGKDYYQTLGLAQGASDEEVKRAYSRQTLRYHPDKNKEPGAEEKFKEIAEAYDLLRDPRK
CQIDHYGEEGLKGSGPSGGSDGGANDTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNE
EEGMDIADPFSGFPMGMGGFTSMNFGRSRPVQEPTRKKQDPPVTHDLRVSLEEIYSGCHK
KMKIPHKRLNPDEKSIQNEGKILTIQVKKGWKEGTKITFPKTSNNIPAEIVFVLKDKPHN
IFKRDGSDVIYPSRIRLRETLCGCTVNVPTLDGRTIPIVFKDVIRPGTLRKVPGEGLCLP
KTPEKRGDLIIELEVIFPERIPQISRTVLEQILPI
Download sequence
Identical sequences ENSMMUP00000037967 9544.ENSMMUP00000003712 ENSMMUP00000003712

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]