SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000038079 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000038079
Domain Number 1 Region: 141-254
Classification Level Classification E-value
Superfamily Bromodomain 7.98e-27
Family Bromodomain 0.00056
Further Details:      
 
Domain Number 2 Region: 259-391
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 3.49e-22
Family PWWP domain 0.008
Further Details:      
 
Domain Number 3 Region: 69-124
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000000197
Family PHD domain 0.011
Further Details:      
 
Domain Number 4 Region: 887-929
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.0000000331
Family MYND zinc finger 0.0097
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000038079
Domain Number - Region: 795-884
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.00392
Family Apolipoprotein A-I 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000038079   Gene: ENSMMUG00000015710   Transcript: ENSMMUT00000045063
Sequence length 1079
Comment pep:known chromosome:MMUL_1:10:17194110:17260106:1 gene:ENSMMUG00000015710 transcript:ENSMMUT00000045063 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DPGSAERTAQKRKFPSPPHSSNGHSPQDTSTSPIKKKKKPGLLNSNNKEQSELRHGPFYY
MKQPLTTDPVDVVPQDGRNDFYCWVCHREGQVLCCELCPRVYHAKCLRLTSEPEGDWFCP
ECEKITVAECIETQSKAMTMLTIEQLSYLLKFAIQKMKQPGTDAFQKPVPLEQHPDYAEY
IFHPMDLCTLEKNAKKKMYGCTEAFLADAKWILHNCIIYNGGNHKLTQIAKVVIKICEHE
MNEIEVCPECYLAACQKRDNWFCEPCSNPHPLVWAKLKGFPFWPAKALRDKDGQVDARFF
GQHDRAWVPINNCYLMSKEIPFSVKKTKSIFNSAMQEMEVYVENIRRKFGVFNYSPFRTP
YTPNSQYQMLLDPTNPSAGTAKIDKQEKVKLNFDMTASPKILMSKPVLSGGTGRRISLSD
MPRSPMSTNSSVHTGSDVEQDAEKKATSSHFSASEESMDFLDKSTASPASTKTGQAGSLS
GSPKPFSPQLSTPITTKTDKTSTTGSILNLNLDRSKAEMDLKELSESVQQQSTPVPLISP
KRQIRSRFQLNLDKTIESCKAQLGINEISEDVYTAVEHSDSEDSEKSDSSDSEYISDDEQ
KSKNEPEDTEDKEGCRMDKEPSAVKKKPKPTNPVEIKEELKSTSPASEKTDPGAVKDKAS
PEPEKDFSEKAKPSPHPTKDKLKGKDETDSPTVHLGLDSDSESELVIDLGEDHSGREGRK
NKKEPKEPSPKQDAVQQKEITQSPSTATITLVTSTQSSPLVTSSGSTSTLVSSVNADLPI
ATASADVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQWLHQ
QELSEMKHNLELTMAEMRQSLEQERDRLIAEVKKQLELEKQQAVDETKKKQWCANCKKEA
IFYCCWNTSYCDYPCQQAHWPEHMKSCTQSATAPQQEADAEVNTETLNKSSQGSSSSTQS
APSETASASKEKETSTEKSKDSGSTLDLSGSRETPSSILLGSNQGSVSKRCDKQPAYAPT
TTDHQPHPNYPAQKYHSRSSKSSWSSSDEKRGSTRAEHNSSTSTKSLLPKESRLDTFWD
Download sequence
Identical sequences ENSMMUP00000038079 9544.ENSMMUP00000020639 ENSMMUP00000020639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]