SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000038134 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000038134
Domain Number 1 Region: 23-114
Classification Level Classification E-value
Superfamily SWIB/MDM2 domain 4.06e-32
Family SWIB/MDM2 domain 0.00028
Further Details:      
 
Domain Number 2 Region: 288-332
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 3.3e-17
Family Ran binding protein zinc finger-like 0.00012
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000038134
Domain Number - Region: 433-479
Classification Level Classification E-value
Superfamily RING/U-box 0.000848
Family RING finger domain, C3HC4 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000038134   Gene: ENSMMUG00000011236   Transcript: ENSMMUT00000045115
Sequence length 487
Comment pep:known chromosome:MMUL_1:1:165894101:165902228:-1 gene:ENSMMUG00000011236 transcript:ENSMMUT00000045115 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSFSTSAQCSTSDSACRISPGQINQVNHFGLSLLIVRKTVNHNMVFYSTQVMHYLGQYI
MVKQLYDQQEQHMVYCGGDLLGELLGRQSFSVKDPSPLYDMLRKNLVTLATATTDAAQTL
ALAQDHSMDIPSQDQLKQSTEESSTSRKRTTEDDIPTLPTSEHKCRNSREDGDLIENLTQ
DETSRLDLGFEEWDVAGLPWWFLGNLRSNYTPRSNGSTDLQTNQVNFTFEGECFFFSFER
SVSEQLGVGIKVEAGDTEQTSEEVGKVSDKKVIEMGKNDDLEDSKSLSDDTDVEVTSEDE
WQCTECKKFNSPSKRYCFRCWALRKDWYSDCSKLTHSLSTSDITAIPEKENEGNDVPDCR
RTISAPVVRPKDVYIKKENSKLFDPCNSVEFLDLAHSSESQETISSTGEQLDNLSEQRTD
TENMEDCQNLLKPCSLCEKRPRDGNIIHGRTGHLVTCFHCARRLKKAGASCPICKKEIQL
VIKVFIA
Download sequence
Identical sequences ENSMMUP00000038134 9544.ENSMMUP00000014729 ENSMMUP00000014729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]