SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000038239 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000038239
Domain Number 1 Region: 5-98
Classification Level Classification E-value
Superfamily Immunoglobulin 4.64e-35
Family V set domains (antibody variable domain-like) 0.0000239
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000038239   Gene: ENSMMUG00000031417   Transcript: ENSMMUT00000045220
Sequence length 102
Comment pep:known scaffold:MMUL_1:1099214164696:214:519:-1 gene:ENSMMUG00000031417 transcript:ENSMMUT00000045220 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QSAPTQPPSVSGSPGQSVTISCTGTSSDIGYYNAVSWYQQHPGTAPKLMIYGVSNRPSGV
SDRFSGSKSGNTASLTISGLQAEDEADYYCCSYTTSSTFHSG
Download sequence
Identical sequences ENSMMUP00000038239 9544.ENSMMUP00000038239 ENSMMUP00000038239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]