SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000038268 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000038268
Domain Number 1 Region: 402-552
Classification Level Classification E-value
Superfamily TRAF domain-like 3.11e-47
Family MATH domain 0.000000666
Further Details:      
 
Domain Number 2 Region: 105-196
Classification Level Classification E-value
Superfamily TRAF domain-like 6.28e-16
Family SIAH, seven in absentia homolog 0.015
Further Details:      
 
Domain Number 3 Region: 39-112
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000464
Family RING finger domain, C3HC4 0.026
Further Details:      
 
Domain Number 4 Region: 192-261
Classification Level Classification E-value
Superfamily TRAF domain-like 0.000000000105
Family SIAH, seven in absentia homolog 0.015
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000038268
Domain Number - Region: 362-399
Classification Level Classification E-value
Superfamily Trimerization domain of TRAF 0.0034
Family Trimerization domain of TRAF 0.0056
Further Details:      
 
Domain Number - Region: 268-311
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.085
Family SNARE fusion complex 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000038268   Gene: ENSMMUG00000031427   Transcript: ENSMMUT00000045246
Sequence length 557
Comment pep:known chromosome:MMUL_1:1:159035115:159062580:-1 gene:ENSMMUG00000031427 transcript:ENSMMUT00000045246 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAYSEEHRGMPCGFIRQNSGNSISLDFEPNIEYQFVERLEERYKCAFCRSVLHNPHQTGC
GHRFCQHCILSLRELNTVPICPVDKEVIKSQEVFKDNCCKREVLNLYVYCSNAPGCNAKV
ILGRYQDHLQQCLFQAVQCSNENCQEPVLRKDLKEHLSAYCQFREEKCLYCKKDVVVINL
QNHEENLCPEYPVFCPNNCAKIILKTEVDEHLAVCPEAEQDCPFKHYGCAVTDKRRNLQE
HEHSALREHMRLVLEKNVQLEEQISDLHKSLEQKESKIQQLAETIKKLEKEFKQFAQLFG
KNGSFLPNIQVFASHIDKSAWLEAQVHQLLQMVNQQQNKFDLRPLMEAVDTVKQKITLLE
NNDQRLAVLEEETNKHDTHINIHKAQLNKNEERFKLLEGTCYNGKLIWKVTDYKMKKREA
VDGHTVSIFSQSFYTGRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQ
RVTLMLLDQSGKKNIMETFKPDPNSSSFKRPDGEMNIASGCPRFVAHSVLENAKNAYIKD
DTLFLKVAVDLTDLEDL
Download sequence
Identical sequences A0A2K5WZV0
9544.ENSMMUP00000038268 XP_005540812.1.63531 XP_014972905.1.72884 XP_014972911.1.72884 ENSMMUP00000038268 ENSMMUP00000038268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]