SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000038341 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000038341
Domain Number 1 Region: 386-449
Classification Level Classification E-value
Superfamily FF domain 4.19e-18
Family FF domain 0.0000204
Further Details:      
 
Domain Number 2 Region: 745-807
Classification Level Classification E-value
Superfamily FF domain 0.00000000000209
Family FF domain 0.0000205
Further Details:      
 
Domain Number 3 Region: 146-180
Classification Level Classification E-value
Superfamily WW domain 0.00000000000278
Family WW domain 0.00033
Further Details:      
 
Domain Number 4 Region: 604-676
Classification Level Classification E-value
Superfamily FF domain 0.0000000000033
Family FF domain 0.0043
Further Details:      
 
Domain Number 5 Region: 521-596
Classification Level Classification E-value
Superfamily FF domain 0.00000000000733
Family FF domain 0.0042
Further Details:      
 
Domain Number 6 Region: 177-215
Classification Level Classification E-value
Superfamily WW domain 0.00000000106
Family WW domain 0.0015
Further Details:      
 
Domain Number 7 Region: 454-523
Classification Level Classification E-value
Superfamily FF domain 0.0000000327
Family FF domain 0.004
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000038341
Domain Number - Region: 62-116
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0602
Family beta-sandwich domain of Sec23/24 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000038341   Gene: ENSMMUG00000010812   Transcript: ENSMMUT00000045316
Sequence length 959
Comment pep:known chromosome:MMUL_1:12:16306807:16370381:-1 gene:ENSMMUG00000010812 transcript:ENSMMUT00000045316 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPGTGAERGGLMVSEMESHPPSQGPGDGERRLSGSSLCSGSWVMLGNKFVRSELSMGHP
GMHYAPMGMHPMGQRANMPPVPHGMMPQMMPPMGGPPMGQMPGMMSSVMPGMMMSHMSQA
SMQPALPPGVNSMDVAAGILFVVKSMWTEHKSPDGRTYYYNTETKQSTWEKPDDLKTPAE
QLLSKCPWKEYKSDSGKPYYYNSQTKESRWAKPKELEDLEGYQNTIVAGSLITKSNLHVV
LWFLEKRFKQEECTTTSTAPVPTTEIPTTMSTMAAAEAAAAVVAAAAAAAAAAAAANANA
STSTSNTVSGTVPVVPEPEVTSIVATVVDNENTVTISTEEQAQLTSTPAIQDQSVEVSSN
TGEETSKQETVADFTPKKEEEESQPAKKTYTWNTKEEAKQAFKELLKEKRVPSNASWEQA
MKMIINDPRYSALAKLSEKKQAFNAYKVQTEKEEKEEARSKYKEAKESFQRFLENHEKMT
STTRYKKAEQMFGEMEVWNAISERDRLEIYEDVLFFLSKKEKEQAKQLRKRNWEALKNIL
DNMANVTYSTTWSEAQQYLMDNPTFAEDEELQNMDKEDALICFEEHIRALEKEEEEEKQK
SLLRERRRQRKNRESFQIFLDELHEHGQLHSMSSWMELYPTISSDIRFTNMLGQPGSTAL
DLFKFYVEDLKARYHDEKKIIKDILKDKGFVVEVNTTFEDFVAIISSTKRSTTLDAGNIK
LAFNSLLEKAEAREREREKEEARKMKRKESAFKSMLKQAAPPIELDAVWEDIRERFVKEP
AFEDITLESERKRIFKDFMHVLEHECQHHHSKNKKHSKKSKKHHRKRSRSRSGSDSDDDD
SHSKKKRQRSESRSASEHSSSAESGEHFSVVENHKFKTTTPLRLMDSPESDAEREKDKKE
KDRESEKDRTRQRSESKHKSPKKKTGKDSGNWDTSGSELSEGELEKRRRTLLEQLDDDQ
Download sequence
Identical sequences ENSMMUP00000038341 9544.ENSMMUP00000038343 ENSMMUP00000038343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]