SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000038449 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000038449
Domain Number 1 Region: 775-966
Classification Level Classification E-value
Superfamily I/LWEQ domain 1.24e-65
Family I/LWEQ domain 0.00000000999
Further Details:      
 
Domain Number 2 Region: 34-145
Classification Level Classification E-value
Superfamily ENTH/VHS domain 8.18e-25
Family ENTH domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000038449   Gene: ENSMMUG00000015221   Transcript: ENSMMUT00000045421
Sequence length 1069
Comment pep:known chromosome:MMUL_1:11:124094881:124116881:1 gene:ENSMMUG00000015221 transcript:ENSMMUT00000045421 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSIKNVPARVLSRRPGHSLEAEREQYSRKEDAISISKAINTQEAPVKEKHARRIILGTH
HEKGAFTFWSYAIGLPLPSSSILSWKFCHVLHKVLRDGHPNVLHDCQRYRSNIREIGDLW
GHLHDRYGQLVNVYTKLLLTKISFHLKHPQFPAGLEVTDEVLEKAAGTDVNNIFQLTVEM
FDYMDCELKLSESVFRQLNTAIAVSQMSTGQCRLAPLIQVIQDCSHLYHYTVKLLFKLHS
CLPADTLQGHRDRFHEQFHSLRNFFRRASDMLYFKRLIQIPRLPEGPPNFLRASALAEHI
KPVVVIPEEAPEDEEPENLIEISMGPPVGEPVVVADLFDQTFGPPNGSVKDDRDLRIESL
KREVEMLRSELEKIKLEAQRYISQLKSQVNALEGELEEQRKQKQKALVDNEQLRHELAQL
RAAQLEGERSQGLREEAERKASATEARYNKLKEKHSELVHVHAELLRKNADTAKQLTVTQ
QSQEEVARVKEQLAFQVEQVKRESELKLEEQSDQLEKLKRELEAKAGELAHVQEALSHTQ
QSKSELSSRLDTLSAEKDALSGAVRQREADLLAAQTLVRETEAALNREQQRSSREQGELQ
GQLAEKESQEQGLRQRLLDEQFAVLQGAAAEAAGILQDAVSKLDDPLHLRCTSSPDYLVS
RAQEALDAVSALEEGHAQYLTSLADASTLVAALTRFSHLAADTIVNGGATSHLAPTDPAD
RLIDTCRECGARALELMGQLQDRQALRHVQASLLRTPLQGILQLGQELKPKSLDVRQEEL
GAMVDKEMATTSAAIEDAVRRIEDMMNQARHASSGVKLEVNERILNSCTDLMKAIRLLVM
TSTSLQKEIVESGRGAATQQEFYAKNSRWTEGLISASKAVGWGATQLVEAADKVVLHMGK
YEELIVCSHEIAASTAQLVAASKVKADKHSPHLSRLQECSRTVNERAANVVASTKSGQEQ
IEDRDTMDFSGLSLIKLKKQEMETQVRVLELEKTLEAERMRLGELRKQHYVLAGASGSPG
EEAASQPSAAPRSVTTKKPPLAQKPSMAPRQDHQLDKKDGIYPAQLVNY
Download sequence
Identical sequences ENSMMUP00000038449 9544.ENSMMUP00000019958 ENSMMUP00000019958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]