SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000038480 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000038480
Domain Number 1 Region: 119-239
Classification Level Classification E-value
Superfamily EF-hand 0.000000000261
Family Calmodulin-like 0.0062
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000038480
Domain Number - Region: 13-61
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.000439
Family YVTN repeat 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000038480   Gene: ENSMMUG00000031503   Transcript: ENSMMUT00000045451
Sequence length 289
Comment pep:known chromosome:MMUL_1:11:123056042:123092700:1 gene:ENSMMUG00000031503 transcript:ENSMMUT00000045451 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IIYTEKCKVVGLQILPVDGNPHKTSAIVCHPNGVAGMAISYDGRYAFTAGGHDRSVVQWK
ITLSVLEAAVSLGGEDLTPFYGLLSGGREGKFYRELEDYFYYSQLRSQGIDTMETRKVSE
YICLSELPFVMRAIGFYPSEEEIDDIFNEIKFGEYVDTGKLIDKINLPDFLKVYLNHKPP
FGNTMSGIHKSFEVLGYTNSKGKKAIRREDFLRLLVTKGEHMTEEEMLDCFASLFGLNPE
GWKSEPATSSVKGSEICLEEELPDEITAEIFATEILGLTISEDSGQDGQ
Download sequence
Identical sequences 9544.ENSMMUP00000038480 ENSMMUP00000038480 ENSMMUP00000038480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]