SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000038672 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000038672
Domain Number 1 Region: 31-556
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 8.47e-157
Family Acetylcholinesterase-like 0.0000000000000888
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000038672   Gene: ENSMMUG00000003742   Transcript: ENSMMUT00000045633
Sequence length 601
Comment pep:known chromosome:MMUL_1:2:121518167:121586602:1 gene:ENSMMUG00000003742 transcript:ENSMMUT00000045633 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHSKVTIICIRLLFWFLLLCMLIGKSHTEDDIVIATKNGKVRGMNLTVLGGTVTAFLGIP
YAQPPLGRLRFKKPQSLTKWSDIWNATKYANSCYQNIDQSFPGFHGSEMWNPNTDLSEDC
LYLNVWIPAPKPKNATVMIWIYGGGFQTGTSSLHVYDGKFLARVERVIVVSMNYRVGALG
FLALPGNPEAPGNMGLFDQQLALQWVQKNIAAFGGNPKSVTLFGESAGAASVSLHLLSPG
SHPLFTRAILQSGSSNAPWAVTSLYEARNRTLTLAKLTGCSRDNETEIVKCLRNKDPHEI
LLNEAFVVPYGTLLSVNFGPTMDGDFLTEMPDILLELGQFKKTQILVGVNKDEGTAFLVY
GAPGFSKDNDSIITRNEFQEGLKIFFPGVSEFGKESILFHYTDWVDDQRPENYREALDDV
VGDYNIICPALEFTKKFSWGNNAFFYYFEHRSSKLPWPEWMGVMHGYEIEFVFGLPLERR
VNYTKAEEILSRSIVKRWANFAKYGNPNGTHNNSTKWPVFKSTEQKYLTLNTESSRILTK
LRAQQCRFWTSFFPKVLEMTGNIDEAEWEWKAGFHRWSNYMMDWKNQFNDYTSKKESCVG
L
Download sequence
Identical sequences ENSMMUP00000004989 ENSMMUP00000038672 9544.ENSMMUP00000004989

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]