SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000038998 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000038998
Domain Number 1 Region: 126-276
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.57e-43
Family Proprotein convertase P-domain 0.0000886
Further Details:      
 
Domain Number 2 Region: 1115-1277
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.3e-31
Family Growth factor receptor domain 0.00054
Further Details:      
 
Domain Number 3 Region: 2-127
Classification Level Classification E-value
Superfamily Subtilisin-like 3.93e-29
Family Subtilases 0.00000467
Further Details:      
 
Domain Number 4 Region: 506-669
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.25e-29
Family Growth factor receptor domain 0.00098
Further Details:      
 
Domain Number 5 Region: 407-569
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.65e-28
Family Growth factor receptor domain 0.00076
Further Details:      
 
Domain Number 6 Region: 308-459
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.33e-27
Family Growth factor receptor domain 0.00025
Further Details:      
 
Domain Number 7 Region: 655-807
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.32e-27
Family Growth factor receptor domain 0.00097
Further Details:      
 
Domain Number 8 Region: 879-1026
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.15e-27
Family Growth factor receptor domain 0.0023
Further Details:      
 
Domain Number 9 Region: 1019-1161
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.05e-25
Family Growth factor receptor domain 0.00098
Further Details:      
 
Domain Number 10 Region: 1265-1422
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.04e-22
Family Growth factor receptor domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000038998   Gene: ENSMMUG00000022023   Transcript: ENSMMUT00000045958
Sequence length 1559
Comment pep:known chromosome:MMUL_1:15:84859576:85116343:1 gene:ENSMMUG00000022023 transcript:ENSMMUT00000045958 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NSIYTISISSTAESGKKPWYLEECSSTLATTYSSGESYDKKIITTDLRQRCTDNHTGTSA
SAPMAAGIIALALEANPFLTWRDVQHVIVRTSRAGHLNANDWKTNAAGFKVSHLYGFGLM
DAEAMVMEAEKWTTVPRQHVCVESTDRQIKTIRPNSAVRSIYKASGCSDNPNRHVNYLEH
VVVRITITHPRRGDLAIYLTSPSGTRSQLLANRLFDHSMEGFKNWEFMTIHCWGERAAGD
WVLEVYDTPSQLRNFKTPGKLKEWSLVLYGTSVQPYSPTNEFPKVERFRYSRVEDPTDDY
GTEDYAGPCDPECSEVGCDGPGPDHCNDCLHYYYKLKNNTRICVSSCPPGHYHADKKRCR
KCAPNCESCFGSHGEQCLSCKYGYFLNEETNSCVTHCPDGSYQDTKKNLCRKCSENCKTC
TEFHNCTECRDGLSLQGSRCSVSCEDGRYFNGQDCQPCHRFCATCAGAGADGCINCTEGY
FMEDGRCVQSCSISYYFDHSSENGYKSCKKCDTSCLTCNGPGFKNCTSCPSGYLLDLGMC
QMGAICKDGEYVDDHGHCQTCEASCAKCRGPTQEDCTTCPMTRILDDGRLSNCPSQKFEF
ENQCHPCHHTCQRCQGSGPTHCTSCEADNYGREYFLYQGECRESCPEGHYATKGNTCLPC
PDNCELCHNMHICTRCTRGYFIAPTNHTCQKLECGQGEVQDPDYEECVPCEEGCLGCSLD
DPGTCTSCAMGYYRFDQHCYKTCPEKTYSEELECKACDSNCGSCDQNGCYWCEEGFFLLG
GSCVRKCGPGFYGDQEMGECEPCHRECETCTGPGHDECSSCREGLQPLRGVCVRATQTQE
EGKFWNEAVPIANLSVVKSLLQERRRWKVQIKRDTLRKSQPCHSSCKTCNGSATLCTSCP
KGAYLLAQACVSSCPQGTWPSVRSRSCENCSEACAVCSGADLCKKCRMQLGLPLFLHEGR
CYSKCPEGSYAEDGVCERCSSPCRTCEGNTTNCHSCEGGLVLHHGVCQETCPERHVAVEG
VCKHCPEMCQDCIHEKTCKECMPEFFLHDDMCHQSCPRGFYSDSRHCVPCHKDCLECSGP
KVDDCELCRESSWVLYDGLCLEECPAGTYYEKETNECRDCHKSCLTCSSSGTCTTCQKGL
RMNPHGSCLANKKCGPSEYWDEDAPGCKPCHTKCFHCTGPAEDQCQTCPRVSLLLNTTCV
KDCPEGYYADEDSHQCARCHSSCRTCEGRHSRQCHSCRPGWFQLGKECLLQCREGYYADN
STGQCERCHRICKGCRGPRPTDCLSCERFFFLLRSKGECRPSCPDHYYVEQSTQTCERCH
PTCGQCKGKGALNCLSCVWSYHLMGGICTSDCLVGEYRVGEGEKFNCEKCHESCMECKGP
GAKNCTLCPANLVLHMDDSRCLHCCNTSDPTSAQECCDCQDTTEECILRTSKVRPAAEHF
KTALFITSSVMLALLLGAAVVVWKKSRGRVQPAAKAGYEKLTDPNKSYSSYKSSYGESTS
FEEDQVIEYRDRDYDEDDDDDIVYMGQDGTVYRKFKYGLLDDDDEDELEYDDESYSYYQ
Download sequence
Identical sequences ENSMMUP00000038998 ENSMMUP00000038998 9544.ENSMMUP00000038998

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]