SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000039174 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000039174
Domain Number 1 Region: 819-847
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000328
Family A20-like zinc finger 0.018
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000039174
Domain Number - Region: 18-55
Classification Level Classification E-value
Superfamily UBA-like 0.000459
Family TAP-C domain-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000039174   Gene: ENSMMUG00000007244   Transcript: ENSMMUT00000046131
Sequence length 857
Comment pep:known chromosome:MMUL_1:1:128296255:128366993:-1 gene:ENSMMUG00000007244 transcript:ENSMMUT00000046131 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFYTSSWLKVLDDHMTLDMDAVLSDFVRSTGAEPGLARDLLEGKNWDVSAALSDFEQLRQ
VHAGNLPPSFSEGIGGSRTPEKGFSDREPSRPPRPILQRQDDIVQEKRLSRGISHASSSI
VSLARSHVSSNGGGGGSNEHPLEMPICAFQLPDLTVYNEDFRSFIERDLIEQSMLVALEQ
AGRLNWWVSVDPTCQRLLPLATTGDGNCLLHAASLGMWGFHDRDLMLRKALYALMEKGVE
KEALKRRWRWQQTQQNKESGLVYTEDEWQKEWNELIKLASSEPRMHLGTNGANCGGVESS
EEPVYESLEEFHVFVLAHVLRRPIVVVADTMLRDSGGEAFAPIPFGGIYLPLEVPASQCH
RSPLVLAYDQAHFSALVSMEQKENTKEQAVIPLTDSEYKLLPLHFAVDPGKGWEWGKDDN
DNVRLASVILSLEVKLHLLHSYMNVKWIPLSSDAQAPLAQPESPTASAGDEPRSTPESGD
SDKESVGSSSTSNEGGRRKEKSKRDREKEKKRADSVANKLGSFGKTLGSKLKKNMGGLMH
SKGSKPGGVGTGSGGSSGTETLEKKKKNALKSWKGGKEEAAGDGPVSEKPPAESIGNGGS
KYSQEVMQSLSILRTAMQGEGKFIFVGTLKMGHRHQYQEEMIQRYLSDAEERFLAEQKQK
EAERKIMNGGIGGGPPPAKKPEPDAREEQPTSPPTESKAMAFSTGYPGGFTIPRPSGGGV
HCQEPRRQLAGGPCVGGLPPYATFPRQCPPGRPYPHQDSIPSLEPGSHSKDGVHRGTLLP
PPYRVANSYSNGYREPPEPDGWAGGLRGLPPTQTKCKQPNCSFYGHPETNNFCSCCYREE
LRRREREPDGELLVHRF
Download sequence
Identical sequences ENSMMUP00000039174 9544.ENSMMUP00000009503 ENSMMUP00000009503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]