SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000039384 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000039384
Domain Number 1 Region: 376-432
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000294
Family UBA domain 0.00014
Further Details:      
 
Domain Number 2 Region: 447-498
Classification Level Classification E-value
Superfamily UBA-like 0.0000321
Family UBA domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000039384   Gene: ENSMMUG00000031826   Transcript: ENSMMUT00000046342
Sequence length 502
Comment pep:known chromosome:MMUL_1:15:43253915:43327143:-1 gene:ENSMMUG00000031826 transcript:ENSMMUT00000046342 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASKKLGADFHGTFSYLDDVPFKIGDKFKTPAKVGLPIGFSLPDCLQVVREVQYDFSLEK
KTIEWAEEIKKIEEAEREAECKIAEAEAKVNSKSGPEGDSKMSFSKTHSTATMPPPINPI
LASLQHNSILTPTRVSSSATKQKVLSPPHIKADFNLADFECEEDPFDNLELKTIDEKEEL
RNILVGTTGPIMAQLLDNNLPRGGSGSVLQDEEVLASLERATLDFKPLHKPNGFITLPQL
GNCEKMSLSSKVSLPPIPAVSNIKSLSFPKLDSDDSNQKTAKLASTFHSTSCLRNGTFQN
SLKPSTQSSASELNGHHTLGLSALNLDSGTEMPALTSSQMPSLSVLSVCTDESSPPNTGP
TVTPANFSVSQVPNMPSCPQAYSELQMLSPSERQCVETVVNMGYSYECVLRAMKKKGENI
EQILDYLFAHGQLCEKGFDPLLVEEALEMHQCSEEKMMEFLQLMSKFKEMGFELKDIKEV
LLLHNNDQDNALEDLMARAGAS
Download sequence
Identical sequences A0A2K5LBG3 A0A2K5Y0K3 G7PS41 I2CT69
NP_001253443.1.72884 XP_005581554.1.63531 XP_011835425.1.47321 XP_011835426.1.47321 XP_011835427.1.47321 XP_011835428.1.47321 XP_011924662.1.92194 XP_014972854.1.72884 XP_015292559.1.63531 XP_015292560.1.63531 ENSMMUP00000039384 9544.ENSMMUP00000039385 ENSMMUP00000039385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]