SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000039424 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000039424
Domain Number 1 Region: 124-260
Classification Level Classification E-value
Superfamily Acid proteases 1.76e-38
Family Retroviral protease (retropepsin) 0.00039
Further Details:      
 
Domain Number 2 Region: 2-111
Classification Level Classification E-value
Superfamily dUTPase-like 4.71e-25
Family dUTPase-like 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000039424   Gene: ENSMMUG00000031839   Transcript: ENSMMUT00000046381
Sequence length 274
Comment pep:known chromosome:MMUL_1:1:114502195:114503019:1 gene:ENSMMUG00000031839 transcript:ENSMMUT00000046381 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGSAAVDLCTIQAVSLLPGEPPRKIPTGVYGPLPEGTVGLILGRSSLNLKGVQIHTGVVD
SDCKGEIQLVISSSIPWSASPGDRIAQLLLLPYIKVGNSEIKRTGGFGSTDPTGKAAYWA
NLVSESRSVCKAIIQGKQFEGLVDTGADISVIALNQWPKNWPKQKAVTRLVGVGTASEVY
ESTMILHCLGPDNQESTVQPMITSIPVNLWGRDLLQQWGAEIIMPAPLYSPTSQKIMTKM
GYIPGKGLGKNENGIKVPIETKKNQERKGIGYPF
Download sequence
Identical sequences ENSMMUP00000039424 ENSMMUP00000039424 9544.ENSMMUP00000039424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]