SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000039464 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000039464
Domain Number 1 Region: 488-653
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 1.11e-71
Family A middle domain of Talin 1 0.0000000351
Further Details:      
 
Domain Number 2 Region: 753-888
Classification Level Classification E-value
Superfamily I/LWEQ domain 2.75e-53
Family I/LWEQ domain 0.000000249
Further Details:      
 
Domain Number 3 Region: 658-782
Classification Level Classification E-value
Superfamily I/LWEQ domain 7.98e-48
Family I/LWEQ domain 0.000000481
Further Details:      
 
Domain Number 4 Region: 1849-1981
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 5.89e-46
Family VBS domain 0.000000514
Further Details:      
 
Domain Number 5 Region: 1233-1369
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 2.51e-38
Family VBS domain 0.015
Further Details:      
 
Domain Number 6 Region: 195-308
Classification Level Classification E-value
Superfamily Second domain of FERM 6.93e-34
Family Second domain of FERM 0.000000558
Further Details:      
 
Domain Number 7 Region: 309-399
Classification Level Classification E-value
Superfamily PH domain-like 1.84e-25
Family Third domain of FERM 0.00000848
Further Details:      
 
Domain Number 8 Region: 2303-2414,2442-2472
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.00000000000000137
Family I/LWEQ domain 0.0024
Further Details:      
 
Domain Number 9 Region: 1083-1215
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000000000000144
Family alpha-catenin/vinculin 0.067
Further Details:      
 
Domain Number 10 Region: 1419-1563
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.00000000000111
Family I/LWEQ domain 0.0081
Further Details:      
 
Domain Number 11 Region: 79-136
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000306
Family First domain of FERM 0.033
Further Details:      
 
Domain Number 12 Region: 1703-1822
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00000314
Family VBS domain 0.024
Further Details:      
 
Domain Number 13 Region: 2017-2140
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000173
Family VBS domain 0.04
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000039464
Domain Number - Region: 1606-1666
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00152
Family VBS domain 0.078
Further Details:      
 
Domain Number - Region: 949-983
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0334
Family I/LWEQ domain 0.0088
Further Details:      
 
Domain Number - Region: 2108-2235
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0484
Family I/LWEQ domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000039464   Gene: ENSMMUG00000031856   Transcript: ENSMMUT00000046424
Sequence length 2527
Comment pep:known chromosome:MMUL_1:15:41795832:41824051:1 gene:ENSMMUG00000031856 transcript:ENSMMUT00000046424 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVALSLKISIGNVVKTMQFEPSTMVYDACRIIRERIPEAPAGPPSDFGLFLSDDDPKKGI
WLEAGKALDYYMLRNGDTMEYRKKQRPLKIRMLDGTVKTIMVDDSKTVTDMLMTICARIG
ITNHDEYSLVRELMEEKKEEVTGTLRKDKTLLRDEKKMEKLKQKLHTDDELNWLDHGRTL
REQGVEEHETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAG
FQCQIQFGPHNEQKHKAGFLDLKDFLPKEYVKQKGERKIFQAHKNCGQMSEIEAKVRYVK
LARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWNLTNIKRWA
ASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIILKKKKSKDHFGLEGDEESTML
EDSVSPKKSTVLQQQYNRVGKVEHGSVALPAIMRSGASGPENFQVGSMPPAQQQITSGQM
HRGHMPPLTSAQQALTGTINSSMQAVQAAQATLDDFDTLPPLGQDAASKAWRKNKMDESK
HEIHSQVDAITAGTASVVNLTAGDPAETDYTAVGCAVTTISSNLTEMSRGVKLLAALLED
EGGSGRPLLQAAKGLAGAVSELLRSAQPASAEPRQNLLQAAGNVGQASGELLQQIGESDT
DPHFQDVLMQLAKAVASAAAALVLKAKSVAQRTEDSGLQTQVIAAATQCALSTSQLVACT
KVVAPTISSPVCQEQLVEAGRLVAKAVEGCVSASQAATEDGQLLRGVGAAATAVTQALNE
LLQHVKAHATGAGPAGRYDQATDTILTVTENIFSSMGDAGEMVRQARILAQATSDLVNAI
KADAEGESDLENSRKLLSAAKILADATAKMVEAAKGAAAYPDSEEQQQRLREAAEGLRMA
TNAAAQNAIKKKLVQRLEHAAKQAAASATQTIAAAQHAASTPKASAGPQPLLVQSCKAVA
EQIPLLVQGVRGSQAQPDSPSTQLALIAASQSFLQPDLPTFLSLRGKMVAAAKASVPTIQ
DQASAMQLSQCAKNLGTALAELRTAAQKAQEACGPLEMDSALSLVQNLEKDLQEVKAAAR
DGKLKPLPGETMEKCAQDLGNSTKAVSSAIAQLLGEVAQGNENYAGIAARDVAGGLRSLA
QAARGVAALTSDPAVQAISPSVDSTLIDSPASASLVAGTAGTHRAQPSWSCRSVSVAKAV
TQALNRCVSCLPGQRDVDNALRAVGDASKRLLSDSLPPSTGTFQEAQSRLNEAAAGLNQA
ATELVQASRGTPQDLARASGRFGQDFSTFLEAGVEMAGQAPSQEDRAQVVSNLKGISMSS
SKLLLAAKALSTDPAAPNLKSQLAAAARAVTDSINQLITMCTQQAPGQKECDNALRELET
VRELLENPVQPINDMSYFGCLDSVMENSKVLGEAMTGISQNAKNGNLPEFGEAISTASKA
LCGFTEAAAQAAYLVGVSDPNSQAGQQGLVEPTQFARANQAIQMACHSLGEPGCTQAQVL
SAATIVAKHTSALCNSCRLASARTANPTAKRQFVQSAKEVANSTANLVKTIKALDGAFTE
ENRAQCRAATAPLLEAVDNLSAFASNPEFSSIPAQISPEGRAAMEPIVISAKTMLESAGG
LIQTARALAVNPRDPPSWSVLAGHSRTVSDSIKKLITSMRDKAPGQLECEAAIAGLNSCL
RDLDQASLAAVSQQLAPREGISQEALHTQMLTAVQEISHLIEPLANAARAEASQLGHKVS
QMAQYFEPLTLAAVGAASKTLSHPQQMALLDQTKTLAESALQLLYTAKEAGGNPKQAAHT
QEALEEAVQMMTEAVEDLTTTLNEAASAAGVVGGMVDSITQAINQLDEGPMGEPEGSFVD
YQTTMVRTAKAIAVTVQEMVTKSNSSPEELGPLANQLTSDYGRLASEAKPAAVAAENEEI
GSHIKHRVQELGHGCAALVTKAGALQCSPSDAYTKKELIECARRVSEKVSHVLAALQAGN
RGTQACITAASAVSGIIADLDTTIMFATAGTLNREGTETFADHREGILKTAKVLVEDTKV
LVQNAAGSQEKLAQAAQSSVATITRLTDVVKLGAASLGAEDPETQVVLINAVKDVAKALG
DLISATKAAAGKVGDDPAVWQLKNSAKVMVTNVTSLLKTVKAVEDEATKGTRALEATTEH
IRQELAVFCSPEPPAKTSTPEDFIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRRAI
ADMLRACKEAAYHPEVAPDVRLRALHYGRECANGYLELLDHVLLTLQKPSPELKQQLTGH
SKRVAGSVTELIQAAEAMKGTEWVDPEDPTVIAENELLGAAAAIEAAAKKLEQLKPRAKP
KEADESLNFEEQILEAAKSIAAATSALVKAASAAQRELVAQGKVSVKYPQEWGRVGTLMS
TPTSIANESLSEENGDVCFYERIEGLSQLGPYLSSQGHFLSAQAAGNAVKRASDNLVKAA
QKAAAFEEQENETVVVKEKMVGGIAQIIAAQEEMLRKERELEEARKKLAQIRQQQYKFLP
SELRDEH
Download sequence
Identical sequences 9544.ENSMMUP00000039464 ENSMMUP00000039464 ENSMMUP00000039464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]