SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000039484 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000039484
Domain Number 1 Region: 1-214
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 5.4e-53
Family Rhodopsin-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000039484   Gene: ENSMMUG00000031869   Transcript: ENSMMUT00000046446
Sequence length 214
Comment pep:known chromosome:MMUL_1:11:52322082:52336872:1 gene:ENSMMUG00000031869 transcript:ENSMMUT00000046446 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRNHTTVANFILLGLTDDPQLQVIIFLLLFFTYMLSVTGNLTIIALTLLDLHLKTPMYFF
LRNFSFLEVSFTTVCIPKFLVSMATGDKTISYNDCAAQLLFFAFLLGASEFLLAAMSYDR
YVAICKPLHYTTIMSSKICMQLVLGCWLAGFVIFPPLLLGLNLDFCASNVINHFYCDTTP
LLQISCTDTQLLDRMGFISALVTLLVTLVMVMVS
Download sequence
Identical sequences ENSMMUP00000039484 9544.ENSMMUP00000039484 ENSMMUP00000039484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]