SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000039489 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000039489
Domain Number 1 Region: 281-455,502-577
Classification Level Classification E-value
Superfamily Kelch motif 1.83e-38
Family Kelch motif 0.0019
Further Details:      
 
Domain Number 2 Region: 6-126
Classification Level Classification E-value
Superfamily POZ domain 4.32e-25
Family BTB/POZ domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000039489   Gene: ENSMMUG00000010214   Transcript: ENSMMUT00000014263
Sequence length 588
Comment pep:known chromosome:MMUL_1:15:41300980:41302746:-1 gene:ENSMMUG00000010214 transcript:ENSMMUT00000014263 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLEFTEKNYNSFVLQNLNRQRKRKEYWDMALSVDHHVFFAHRNVLAAVSPLVRSLISSN
DMKTTDELFITIDSSYLSPVTVDQLLDYFYSGKVVISEQNVEELLRGAQYFNTPRLRVHC
NDFLIKSIRRANCLRYLFLAELFELKEVSDLAYSGIRDNFHYWASPEGSMHFMRCPPVIF
GRLLRDENLHVLNEDQALSALINWVYFRKEEREKYFKKFFNYINLNAVSNKTLVFASNKL
VGMENSSSHATLIENVLMDRKQERPCSLLVYQRKGALLDSVVILGGQKAHGQFNDGVFAY
IIQENLWMKLSDMPYRAAALSATSAGRYIYISGGTTEQISGLKTAWRYDMDDNSWTKLPD
LPIGLVFHTMVTCGGTVYSVGGSIAPRRYVSNIYRYDERKEVWCLAGKMSIPMDGTAVIT
KGDRHLYIVTGRCLVKGYISRVGVVDCFDTSTGDVVQCITFPIEFNHRPLLSFQQDNILC
VHSHRQSVEINLQKVKASKTTTSVPLLPNNCPLDVSHAICSIGDSKVFVCGGVTTASDVQ
TKDYTINPNAFLLDQKTGEWKTLAAPPEALDCPACCLAKLPCKILQRI
Download sequence
Identical sequences F7HIY6
NP_001185627.1.72884 ENSMMUP00000039489 9544.ENSMMUP00000039489 ENSMMUP00000039489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]