SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000039532 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000039532
Domain Number 1 Region: 53-130
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.48e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.000046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000039532   Gene: ENSMMUG00000013756   Transcript: ENSMMUT00000019311
Sequence length 137
Comment pep:known chromosome:MMUL_1:1:112158493:112159307:-1 gene:ENSMMUG00000013756 transcript:ENSMMUT00000019311 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ANSPVICVGGQDAYSVQGQHTISLLDLVKLNQVARQQSHFAMMHSGTGFTQIDSSSPETQ
TTHKFTIPNNLIGCVIGPQGANINEIRQMSGAWIKTTNPVEGSSDRQGTITGSAASISLG
QYLIDARLSSEKGMGHS
Download sequence
Identical sequences ENSMMUP00000039532 ENSMMUP00000039532 9544.ENSMMUP00000039532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]