SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000039566 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000039566
Domain Number 1 Region: 290-498
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 9.78e-58
Family Reprolysin-like 0.00069
Further Details:      
 
Domain Number 2 Region: 588-644
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000706
Family TSP-1 type 1 repeat 0.00043
Further Details:      
 
Domain Number 3 Region: 1109-1167
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000602
Family TSP-1 type 1 repeat 0.003
Further Details:      
 
Domain Number 4 Region: 1185-1241
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000719
Family TSP-1 type 1 repeat 0.0066
Further Details:      
 
Domain Number 5 Region: 1382-1441
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000824
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 
Domain Number 6 Region: 1051-1110
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000222
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 
Domain Number 7 Region: 1555-1614
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000471
Family TSP-1 type 1 repeat 0.0038
Further Details:      
 
Domain Number 8 Region: 995-1055
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000484
Family TSP-1 type 1 repeat 0.0028
Further Details:      
 
Domain Number 9 Region: 1236-1297
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000589
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 
Domain Number 10 Region: 1446-1500
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000785
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 
Domain Number 11 Region: 1329-1385
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000929
Family TSP-1 type 1 repeat 0.0025
Further Details:      
 
Domain Number 12 Region: 1682-1730
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000209
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 13 Region: 1617-1677
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000235
Family TSP-1 type 1 repeat 0.0047
Further Details:      
 
Domain Number 14 Region: 1498-1556
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000288
Family TSP-1 type 1 repeat 0.0053
Further Details:      
 
Domain Number 15 Region: 879-934
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000863
Family TSP-1 type 1 repeat 0.0049
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000039566
Domain Number - Region: 940-995
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0111
Family TSP-1 type 1 repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000039566   Gene: ENSMMUG00000000265   Transcript: ENSMMUT00000046533
Sequence length 1937
Comment pep:known chromosome:MMUL_1:2:71715278:71889076:1 gene:ENSMMUG00000000265 transcript:ENSMMUT00000046533 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQFVSWATLLTLLVRDLAEMGIPDAAAAVRKDRLHPRQVKLLETLSEYEIVSPIRVNALG
EPFPTNVHFKRRRRSINSATDPWPAFASSSSSSTSSQAHYRLSAFGQQFLFNLTANAGFI
APLFTVTLLGTPGVNQTKFYSEEEAELKHCFYKGYVNTKSEHTAVISLCSGMLGTFRSYD
GDYFIEPLQSMDEQEDEEEQNKPHIIYRRSTPQREPSTGRHACDTSEHKNRHSKDKKKTR
ARKWGERINLADDVAALNSGLATEAFSAYGNKTDNTTEKRTHRRTKRFLSYPRFVEVLVV
ADNRMVSYHGENLQHYILTLMSIVASIYKDPSIGNLINIVIVNLIVIHNEQDGPSISFNA
QTTLKNFCQWQHSKNSPGGIHHDTAVLLTRQDICRAHDKCDTLGLAELGTICDPYRSCSI
SEDSGLSTAFTIAHELGHVFNMPHDDNNKCKEEGVKSPQHVMAPTLNFYTNPWMWSKCSR
KYITEFLDTGYGECLLNEPESRPYPLPVQLPGILYNVNKQCELIFGPGSQVCPYMMQCRR
LWCNNVNGVHKGCRTQHTPWADGTECEPGKAKHCKYGFCVPKEMDVPVTDGSWGSWSPFG
TCSRTCGGGIKTAIRECNRPEPKNGGKYCVGRRMKFKSCNTEPCLKQKRDFRDEQCAHFD
GKHFNINGLLPNVRWVPKYSGILMKDRCKLFCRVAGNTAYYQLRDRVIDGTPCGQDTNDI
CVQGLCRQAGCDHVLNSKARRDKCGVCGGDNSSCKTVAGTFNTVHYGYNTVVRIPAGATN
IDVRQHSFSGETDDDNYLALSSSKGEFLLNGNFVVTMAKREIRIGNAVVEYSGSETAVER
INSTDRIEQELLLQVLSVGKLYNPDVRYSFNIPIEDKPQQFYWNSHGPWQACSKPCQGER
KRKLVCTRESDQLTVSDQRCDRLPQPGPITEPCGTDCDLRWHVASRSECSAQCGLGYRTL
DIYCAKYSRLDGKTEKVDDGFCSSHPKPSNREKCSGECNTGGWRYSAWTECSKSCDGGTQ
RRRAICVNTRNDVLDDSKCTHQEKVTIQRCSEFPCPQWKSGDWSECLVTCGKGHKHRQVW
CQFGEDRLNDRMCDPETKPTSMQTCQQPECASWQAGPWGQCSVTCGQGYQLRAVKCIIGT
YMSVVDDNDCNAATRPTDTQDCELPSCHPPPAAPETRRSTYSAPRTQWRFGSWTPCSATC
GKGTRMRYVSCRDENGSVADESACATLPRPVAKEECSVTPCGQWKALDWSSCSVTCGQGR
ATRQVVCVNYSDHVIDRSECDQDYIPETDQDCSMSPCPQRTPDSGLAQHPFQNEDYRPRS
ASPSRTHVLGGNQWRTGPWGACSSTCAGGSQRRVVVCQDENGYTANDCVERIKPDEQRAC
ESGPCPQWAYGNWGECTKLCGGGIRTRLVVCQRSNGERFPDLSCEILDKPPDREQCNTHA
CPHDAAWSTGPWSSCSVSCGRGHKQRNVYCMAKDGSHLESDYCKHLAKPHGHRKCRGGRC
PKWKTGAWSQCSVSCGRGVQQRHVGCQIGTHKIARETECNPYTRPESERDCQGPRCPLYT
WRAEEWQECTKTCGEGSRYRKVVCVDDSKNEVHGARCDVSKRPADHESCSLQPCEYVWIT
GEWSECSVTCGKGYKQRLVSCSEIYTGKENYEYSYQTTVNCPGTQPPSVHPCYLRECPVS
ATWRVGNWGSCSVSCGVGVMQRSVQCLTNEDQPSHLCHTDLKPEERKTCRNIYNCELPQN
CKEVKRLKGASEDGEYFLMIRGKLLKIFCAGMHSDHPKEYVTLVHGDSENFSEVYGHRLH
NPTECPYNGSRRDDCQCRKDYTAAGFSSFQKIRIDLTSMQIITTDLQFARTSEGHPVPFA
TAGDCYSAAKCPQGRFSINLYGTGLSLTESARWISQGNYAVSDIKKSPDGTRVIGKCGGY
CGKCTPSSGTGLEVRVL
Download sequence
Identical sequences ENSMMUP00000039566 9544.ENSMMUP00000039566 ENSMMUP00000039566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]