SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000039627 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000039627
Domain Number 1 Region: 1-91
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.91e-25
Family Ubiquitin-related 0.00000663
Further Details:      
 
Domain Number 2 Region: 272-339
Classification Level Classification E-value
Superfamily XPC-binding domain 3.4e-24
Family XPC-binding domain 0.0000183
Further Details:      
 
Domain Number 3 Region: 174-230
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000000559
Family UBA domain 0.00064
Further Details:      
 
Domain Number 4 Region: 356-407
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000172
Family UBA domain 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000039627   Gene: ENSMMUG00000014944   Transcript: ENSMMUT00000026714
Sequence length 409
Comment pep:known chromosome:MMUL_1:15:28868243:28914930:-1 gene:ENSMMUG00000014944 transcript:ENSMMUT00000026714 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQVTLKTLQQQTFKIDIDPEETVKALKEKIESEKGKDAFPVAGQKLIYAGKILNDDTALK
EYKIDEKNFVVVMVTKPKAVSTPAPATTQQSAPASTTAITSSTATTVAQAPTPVPALAPT
STPASITPASATASSEPAPASATKQEKPAEKPAETPVATSPTATDSTSGDSSRSNLFEDA
TSALVTGQSYENMVTEIMSMGYEREQVIAALRASFNNPDRAVEYLLMGIPGDRESQAVVD
PPQAASTGAPQSSAVAAAAATTTATTTTTSSGGHPLEFLRNQPQFQQMRQIIQQNPSLLP
ALLQQIGRENPQLLQQISQHQEHFIQMLNEPVQEAGGQGGGGGGGSGGIAEAGSGHMNYI
QVTPQEKEAIERLKALGFPEGLVIQAYFACEKNENLAANFLLQQNFDED
Download sequence
Identical sequences A0A2K5UZ30 H9YX93
9544.ENSMMUP00000019602 ENSMMUP00000039627 ENSMMUP00000019602 NP_001248717.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]