SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000039728 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000039728
Domain Number 1 Region: 100-166
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000000244
Family PHD domain 0.012
Further Details:      
 
Domain Number 2 Region: 191-269
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000354
Family PHD domain 0.01
Further Details:      
 
Domain Number 3 Region: 45-94
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000000000165
Family Tudor domain 0.0089
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000039728
Domain Number - Region: 569-590
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0874
Family Chromo domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000039728   Gene: ENSMMUG00000016808   Transcript: ENSMMUT00000046698
Sequence length 593
Comment pep:known chromosome:MMUL_1:1:96083386:96141302:1 gene:ENSMMUG00000016808 transcript:ENSMMUT00000046698 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RDSTGAGNSLVHKRSPLRRNQKTPTSLTKLSLQDGHKAKKPACKFEEGQDVLARWSDGLF
YLGTIKKINILKQSCFIIFEDSSKSWVLWKDIQTGSATGSGEMVCTICQEEYSKAPNEMV
ICDKCGQGYHQLCHTPHIDSSVIDSDEKWLCRQCVFATTTKRGGALKKGPNAKALQVMKQ
TLPYSVADLEWDAGHKTNVQQCYCYCGGPGDWYLKMLQCCKCKQWFHEACVQCLQKPMLF
GDRFYTFICSVCSSGPEYLKRLPLQWVDIAHLCLYNLSVIHKKKYFDSELELMTYINENW
DRLHPGELADTPKSERYEHVLEALNDYKTMFMSGKEIKKKKHLFGLRIRVPPVPPNVAFK
AEKEPEGTSHEFKIKGRKASKPISDSREVSNGIEKKGKKKSVGRPPGPYTRKMIQKTAEP
LLDKESVSENPTLDLPCSIGRTEGTAHSSNTSDVDFTGASSAKETTSSSISRHYGLSDSR
KRTRTGRSWPAAIPHLRRRRGRLPRRALQTQNSEIVKDDEGKEDYQFDELNTEILNNLAD
QELQLNHLKNSITSYFGAAGRIACGEKYRVLARRVTLDGKVQYLVEWEGATAS
Download sequence
Identical sequences ENSMMUP00000039728 9544.ENSMMUP00000022097 ENSMMUP00000022097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]