SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000039752 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000039752
Domain Number 1 Region: 71-356
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 5.72e-74
Family Epoxide hydrolase 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000039752   Gene: ENSMMUG00000031975   Transcript: ENSMMUT00000046724
Sequence length 362
Comment pep:known chromosome:MMUL_1:1:95015008:95049846:1 gene:ENSMMUG00000031975 transcript:ENSMMUT00000046724 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARLRDCLPRLMLTLRSLLFWSLVYCYCGLCASIHLLKLLWSLGKGPAQTFRRSPREHPP
ACLSDPSLGTHCYVRIKDSGLRFHYVAAGERGKPLMLLLHGFPEFWYSWRYQLREFKSEY
RVVALDLRGYGETDAPIHRQNYKLDCLITDIKDILDSLGYSKCVLIGHDWGGMIAWLIAI
CYPEMVMKLIVINFPHPNVFTEYILRHPAQLLKSSYYYFFQIPWFPEFMFSINDFKVLKH
LFTSHSTGIGRKGCQLTTEDLEAYIYVFSQPGALSGPINHYRNIFSCLPLKHHMVTTPTL
LLWGENDAFMEVEMAEVTKIYVKNYFRLTILSEASHWLQQDQPDIVNKLIWTFLKEETRK
KD
Download sequence
Identical sequences A0A096N6Q8 A0A0D9S6S2 A0A2K5LE46 A0A2K5TKF8 A0A2K6CD51 F7GW92
ENSMMUP00000039752 ENSPANP00000008185 ENSMMUP00000039752 XP_001098374.1.72884 XP_005542804.1.63531 XP_007976165.1.81039 XP_011745992.1.29376 XP_011923377.1.92194 9544.ENSMMUP00000039752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]