SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000039798 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000039798
Domain Number 1 Region: 20-181,211-273
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.09e-68
Family BAR domain 0.00049
Further Details:      
 
Domain Number 2 Region: 265-297,328-385
Classification Level Classification E-value
Superfamily SH3-domain 2.23e-18
Family SH3-domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000039798   Gene: ENSMMUG00000013487   Transcript: ENSMMUT00000046769
Sequence length 386
Comment pep:known chromosome:MMUL_1:1:89416357:89455606:1 gene:ENSMMUG00000013487 transcript:ENSMMUT00000046769 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNIMDFNVKKLAADAGTFLSRAVQFTEEKLGQAEKTELDAHLENLLSKAECTKIWTEKIM
KQTEVLLQPNPNARIEEFVYEKLDRKAPSRINNPELLGQYMIDAGTEFGPGTAYGNALIK
CGETQKRIGTADRELIQTSALNFLTPLRNFIEGDYKTIAKERKLLQNKRLDLDAAKTRLK
KAKAAETRNSQLNSARLEGDNIMIWAEEVTKSEQELRITQSEFDRQAEITRLLLEGISST
HAHHLRCLNDFVEAQMTYYAQCYQYMLDLQKQLGSFPSNYLSNNNQTSVAPVPSVLPNAI
GSSAMASTSGLVITSPSNLSDLKECSGSRKARVLYDYDAANSTELSLLADEVITVFSVVG
MDSDWLMGERGNQKGKVPITYLELLN
Download sequence
Identical sequences A0A0D9S6U4 A0A2K5XA27 F6ZLA9 G7NTL9
XP_005542874.1.63531 XP_007976258.1.81039 XP_011741428.1.29376 XP_011837485.1.47321 XP_011932403.1.92194 XP_014999324.1.72884 ENSMMUP00000017727 9544.ENSMMUP00000017727 ENSMMUP00000039798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]