SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000039805 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000039805
Domain Number 1 Region: 41-242
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.6e-27
Family Laminin G-like module 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000039805   Gene: ENSMMUG00000013205   Transcript: ENSMMUT00000046778
Sequence length 1714
Comment pep:known chromosome:MMUL_1:1:88500484:88705031:-1 gene:ENSMMUG00000013205 transcript:ENSMMUT00000046778 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHLGAHRTRRGKVSPTAKTKPLLHFIVLCVAGVVVHAQEQGIDILHQLGLGGKDVRHSSS
ATAVPASSTPLPQGVHLIESGVILKNDAYIETPFMKILPVNLGRPFTILTGLQSHRVNNA
FLFSIRNKNRLQLGVQLLPKKLVVHIRGKQAVVFNYSVHDEQWHLFAITIRNQSVSMFVE
CGKKYFNTETISEVQTFDSNSVFTLGSMNNNSVHFEGIVCQLDIIPSAEASADYCRYVKQ
QCRQTDKYQPETSLPHTTLIPTKILEHSPPPKRFAEKVLSEDTFTEGRSIPNIINNDSET
VYKRREHQISRSQLSSLQSGNVSAVDLTNHGIQAKEMITEEDTQTNLSLSVTPHRISEAG
MNTKEKFSSLLNVSDNITQHDDRLTGLSLFKKMPSILPQITQDAITNLKKAITANLHTNE
LMEMQPILNTSLYRVSNEPSVDNHLDLRKEGEFYPDATYPIENSYETELYDYYYYEDLNT
MLEMEYLRGPKGDTGPPGPPGPAGIPGPSGKRGPRGIPGPHGNPGLPGLPGPKGPKGDPG
FSPGQAVPGEKGDQGLSGLMGPPGMQGDKGLKGHPGLPGLRGEQGIPGFAGNIGSPGYPG
RQGLAGPEGHPGPKGARGFIGSPGEAGQLGPEGERGIPGIRGKKGFKGRQGFPGDFGDRG
PAGLDGSPGLVGGTGPPGFPGLRGSVGPVGPIGPAGIPGPVGLSGNKGLPGIKGDKGEQG
SAGELGEPGYPGDKGAVGLPGPQGMRGKPGPSGQTGDPGLQGPSGPPGPEGFPGDIGIPG
QNGPEGPKGLLGNRGPPGPPGLKGTQGEEGPIGPFGELGPRGKPGQKGYAGEPGPEGLKG
EVGDQGNIGKIGETGPVGLPGEVGTTGSIGEKGERGSPGPLGPQGEKGVMGYPGPPGVPG
PIGPLGLPGHVGARGPPGSQGPKGQRGPRGPDGLLGEQGIQGAKGEKGDQGKRGPHGLIG
KTGNPGERGVQGKPGLQGLPGSTGDRGLPGEPGLRGLQGDVGPPGEMGIEGPPGIEGESG
LQGEPGAKGDVGPAGSVGEPGEPGLRGEPGAPGEEGLQGKDGLKGASGGRGLPGEDGEKG
DMGLPGIIGPLGRSGQMGLPGPEGIVGIPGQRGRLGKKGDKGQIGPTGEVGSRGSPGKIG
KSGPKGARGTRGAVGHLGLMGPDGEPGIPGYRGHQGQPGLSGLPGPKGEKGYPGEDSTVL
GPPGPRGEPGPVGEQGERGEPGAEGYKGHVGVPGLRGATGQQGPPGEPGDQGEQGLKGER
GCEGHKGKKGAPGPSGKAGIPGLQGLPGPKGIQGYHGADGILGNPGKVGPPGKQGLPGIR
GSPGRTGLAGAPGPPGVKGSSGLPGSPGIQGPKGEQGLPGQPGIQGTRGHRGAQGDQGPC
GEPGLKGQPGEYGVQGLTGFQGFPGPKGPEGDAGIVGISGPKGPIGQRGNTGPLGREGII
GPTGRTGPRGEKGFRGETGPQGLRGQPGPPGPPGAPGPRKQMDINAAIQALIESNTALQM
ENYQNTEVTLIDHSEEIFKTLNYLSNLLHSIKNPLGTRDNPARICKDLLNCEQKVSDGKY
WIDPNLGCPSDAIEVFCNFSAGGQTCLPPVSGTKLEFGVGKVQMNFLHLLSSEATHIITI
HCLNTPRWTSTQTSGPGLPIGFKGWNGQIFKVNTLLEPKVLSDDCKIQDGSWHKATFLFH
TQEPNQLPVIEVQKLPHLKTERKYYIESSSVCFL
Download sequence
Identical sequences XP_001109249.1.72884 ENSMMUP00000017348 9544.ENSMMUP00000017348 ENSMMUP00000039805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]