SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000039997 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000039997
Domain Number 1 Region: 3-172
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.81e-47
Family FCH domain 0.0000000214
Further Details:      
 
Domain Number 2 Region: 444-493
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000315
Family SH3-domain 0.0024
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000039997
Domain Number - Region: 289-361
Classification Level Classification E-value
Superfamily HR1 repeat 0.012
Family HR1 repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000039997   Gene: ENSMMUG00000003799   Transcript: ENSMMUT00000046966
Sequence length 501
Comment pep:known chromosome:MMUL_1:15:8882573:8946047:1 gene:ENSMMUG00000003799 transcript:ENSMMUT00000046966 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NFHDGRKAQQHIETCWKQLESSKRRFERDCKEADRAQQYFEKMDADINVTKADVEKARQQ
AQIRHQMAEDSKADYSSILQKFNHEQHEYYHTHIPNIFQKIQEMEERRIVRIGESMKTYA
EVDRQVIPIIGKCLDGIVKAAESIDQKNDSQLVIEAYKSGFEPPGDIEFEDYTQPMKRTV
SDNSLSNSRGEGKPDLKFGGKSKGKLWPFIKKNKLMSLLTSPHQPPPPPPASASPSAVPN
GPQSPKQQKEPLSHRFNEFMTSKPKIHCFRSLKRGVRSRMGATPEDFSNLPPEQRRKKLQ
QKVDELSKEIQKEMDQRDAITKMKDVYLKNPQMGDPASLDHKLAEVSQNIEKLRLETQKF
EAWLAEVEGRLPARSEQARRQSGLYDSQNPPTVNNCAQDRESPDGSYTEEQSQESEVKVR
TPTFLPLLAFYLRLPRHLKYPDVAFSGQNEGTISVVEGETLYVIEEDKGDGWTRIRRNED
EEGYVPTSYVEVCLDKNAKGA
Download sequence
Identical sequences 9544.ENSMMUP00000039997 ENSMMUP00000039997 ENSMMUP00000039997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]