SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000040106 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000040106
Domain Number 1 Region: 25-113
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 1.89e-33
Family MHC antigen-recognition domain 0.00000607
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000040106   Gene: ENSMMUG00000001660   Transcript: ENSMMUT00000047080
Sequence length 154
Comment pep:known scaffold:MMUL_1:1099548049460:21014:22682:1 gene:ENSMMUG00000001660 transcript:ENSMMUT00000047080 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVVMAPRTLLLLLSGALALTETWAGSHSMRYFSAAVSRPGRGEPRFIPVGYVDNTQFVRL
DSDAASPRMEPRAPWVEQEGPEYWEEETRNIKAHAHTDRVNLRTLRSCYNQSQAEQSFQP
TIPIMGIIAGLVVFAAVVTEAVVTFVLWRKKSSG
Download sequence
Identical sequences ENSMMUP00000040106 ENSMMUP00000002225 9544.ENSMMUP00000002225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]