SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000040217 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000040217
Domain Number 1 Region: 235-280
Classification Level Classification E-value
Superfamily UBA-like 0.0000000434
Family TS-N domain 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000040217   Gene: ENSMMUG00000019055   Transcript: ENSMMUT00000047191
Sequence length 462
Comment pep:known chromosome:MMUL_1:1:53247507:53250356:-1 gene:ENSMMUG00000019055 transcript:ENSMMUT00000047191 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWCLHSRATNATVAGRTACAPSARSSRSASVSWRRRWRCAGSRRRRRTRRASCSCSTVL
PRGWRWPQPTASSPRGPPTRSSVQCAPPTGGPGAGAPAGTGGGAAGAGGSEAKLQKFDLF
PKTLLQAGRPGSPQPPPVKPLSPDGADSGPGTSSPEVRPGSGSENGDGESFSGSPLARAS
KEAGGSCPGSAGPGGGGGEEDSPGSASPLGSESGSEADKEEGEAAPAPGLGGGSGPRQRT
PLDILTRVFPGHRRGVLELVLQGCGGDVVQAIEQVLNHHRGGLAAGLGPAAPPDKAAVGA
AAAADDAWPGRVDAAASGGPGLPAPLQAGPAAPPHHRPLLAGAMAPGALGSLSSRSAFSP
LQPNASHFGAEAGAYPLGAPLGLSPLRLAYSAAAAHSRGLAFMAPYSTAGLVPTLGFRPP
MDYAFSDLMRDRSAAAAAAVHKEPTYGGGLYGPMVNGAPEKQ
Download sequence
Identical sequences ENSMMUP00000040217 9544.ENSMMUP00000025050 ENSMMUP00000025050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]