SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000040303 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000040303
Domain Number 1 Region: 326-560
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.97e-20
Family Clostridium neurotoxins, the second last domain 0.043
Further Details:      
 
Domain Number 2 Region: 144-254
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000124
Family Cadherin 0.0033
Further Details:      
 
Domain Number 3 Region: 36-156
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000257
Family Cadherin 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000040303   Gene: ENSMMUG00000008899   Transcript: ENSMMUT00000047276
Sequence length 967
Comment pep:known chromosome:MMUL_1:11:7438913:7465419:1 gene:ENSMMUG00000008899 transcript:ENSMMUT00000047276 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLRCELSGSTRVVVGVEALLTGASSPLPGLGPANKHKPWIEAEYQGIVMENDNTVLLNPP
LFALDKDAPLRYAGEICGFRLHGSGVPFEAVILDKATGEGLIRAKEPVDCEAQKEHTFTI
QAYDCGEGPDGANTKKSHKATVHVRVNDVNEFAPVFVERLYRAAVTEGKLYDRILRVEAI
DGDCSPQYSQICYYEILTPNTPFLIDNDGNIENTEKLQYSGERLYKFTVTAYDCGKKRAA
DDAEVEIQVKPTCKPSWQGWNKRIEYAPGAGSLALFPGIRLETCDEPLWNIQATIELQTS
HVAKGCDRDNYSERALRKLCGAATGEVDLLPMPGPNANWTAGLSVHYSQDSSLIYWFNGT
QAVQVPLGGPSGLGSGPQDSLSDHFTLSFWMKHGVTPNKGKKEEETIVCNTVQNEDGFSH
YSLTVHGCRIAFLYWPLLESARPVKFLWKLEQVCDDEWHHYALNLEFPTVTLYTDGISFD
PALIHDNGLIHPPRREPALMIGACWTEEKNKEKEKGDNSTDITQGDPLPIHHYFHGYLAG
FSVRSGRLESREVIECLYACREGLDYRDFESLGKGMKVHVNPSQSLLTLEGDDVETFNHA
LQHVAYMNTLRFATPGVRPLRLTTAVKCFSEESCVSIPEVEGYVVVLQPDAPQILLSGTA
HFARPAVDFEGTEGVPLFPDLQITCSISHQVEAKKDESWQGTVTDTRMSDEIVHNLDGCE
ISLVGDDLDPERESLLLDTTSVQQRGLELTNTSAYLTIAGVESITVYEEILRQARYRLRH
GAALYARKFRLSCSEMNGRYSSNEFIVEVNVLHSMNRVAHPSHVLSSQQFLHRGHQPPPE
MAGHSLASSHRNSMIPSAATLIIVVCVGFLVLMVVLGLVRIHSLHRRVSGAGGPPGASGD
PKDPDLFWDDSALTIIVNPMESYQNRQACVAGAAGGQQEDEDSSDSEVADSPSSDERRII
ETPPHRY
Download sequence
Identical sequences 9544.ENSMMUP00000040303 ENSMMUP00000040303 ENSMMUP00000040303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]