SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000040576 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000040576
Domain Number 1 Region: 213-274
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000112
Family LIM domain 0.0073
Further Details:      
 
Domain Number 2 Region: 271-340
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000285
Family LIM domain 0.026
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000040576
Domain Number - Region: 182-211
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00102
Family LIM domain 0.075
Further Details:      
 
Domain Number - Region: 141-204
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0141
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000040576   Gene: ENSMMUG00000032243   Transcript: ENSMMUT00000047545
Sequence length 375
Comment pep:known chromosome:MMUL_1:1:18552557:18564664:1 gene:ENSMMUG00000032243 transcript:ENSMMUT00000047545 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASKPEKRVASSVFITLAPPRRDVAVAEEVRQAVCEARRGRPWAPPAPVKTPEAGLARRP
SPWTPPGKAATTVPAAPLQLSNGGCPPPPPVLDGEDVLPDLDLLPPPPPPPPVLLPSEEE
APAPMGTSLIADLQQLHLSPPPPPPPPQAPAEGPSVQPGPLRPVEEELPPPPAEPVEKEA
STDICAFCHKTVSPRELAVEAMKRQYHAQCFTCRTCRRQLAGQSFYQKDGRPLCEPCYQD
TLEKCGKCGEVVQDHIIRALGQAFHPSCFTCVTCARCIGDESFALGSQNEVYCLDDFYRK
FAPVCSICENPIIPRDGKDAFKIECMGRNFHENCYRCEDCRILLSVEPTDQGCYPLNNRL
FCKPCHVKRSAAGCC
Download sequence
Identical sequences A0A2K5VP58 F7FNP3
ENSMMUP00000040576 9544.ENSMMUP00000040578 XP_001084013.1.72884 XP_005544767.1.63531 XP_014975136.1.72884 XP_014975200.1.72884 XP_015297837.1.63531 XP_015297842.1.63531 XP_015297852.1.63531 XP_015297856.1.63531 XP_015297864.1.63531 XP_015297866.1.63531 XP_015297872.1.63531 XP_015297881.1.63531 ENSMMUP00000040578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]