SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000040799 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000040799
Domain Number - Region: 7-79
Classification Level Classification E-value
Superfamily Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 0.0288
Family Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000040799   Gene: ENSMMUG00000011353   Transcript: ENSMMUT00000047772
Sequence length 91
Comment pep:known scaffold:MMUL_1:1099214418854:3:561:1 gene:ENSMMUG00000011353 transcript:ENSMMUT00000047772 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SIEHSDYRAKLSQIRQIYHSELEKYEQACREFTTHVTNLLQEQSRMRPVSPKEIERMVGA
IHGKFSAIQMQLKQSTCEAVMTLRSRLLDAR
Download sequence
Identical sequences ENSMMUP00000040799 9544.ENSMMUP00000040799 ENSMMUP00000040799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]