SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000040909 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000040909
Domain Number 1 Region: 32-215
Classification Level Classification E-value
Superfamily NTF2-like 1.13e-65
Family NTF2-like 0.000000891
Further Details:      
 
Domain Number 2 Region: 213-279
Classification Level Classification E-value
Superfamily UBA-like 3.83e-25
Family TAP-C domain-like 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000040909   Gene: ENSMMUG00000032390   Transcript: ENSMMUT00000047878
Sequence length 283
Comment pep:known chromosome:MMUL_1:X:100876731:100882246:-1 gene:ENSMMUG00000032390 transcript:ENSMMUT00000047878 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAIRDCFPKLLRLDGRELSAPMIVDIDSSEIMKPCKENFTGSETLKHLVLQFLQQYYSIY
DSGDRQGLLGAYHDEACFSLAIPFDAEDSAPNSLRKYFEDSRNMKTLKDPHLKGELLRHT
KRDIVDSLSALPKTQHDLSSILVDMWCQTEWMLCFSVNGVFKEVEGQSQGSVLAFTRTFI
ATPGGSSSLCIVNDELFVRDASPQETQSAFSIPVSTLSSSSEPSLSQEQQEMVQAFSAQS
GMKLEWSQKCLQDNEWNYTRAGQVFTMLQTEGKIPAEAFKQIS
Download sequence
Identical sequences ENSMMUP00000040909 ENSMMUP00000040909 9544.ENSMMUP00000040909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]