SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000041020 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000041020
Domain Number 1 Region: 186-322
Classification Level Classification E-value
Superfamily L30e-like 1.07e-33
Family ERF1/Dom34 C-terminal domain-like 0.00000473
Further Details:      
 
Domain Number 2 Region: 3-76
Classification Level Classification E-value
Superfamily N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 9.94e-29
Family N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 0.0000127
Further Details:      
 
Domain Number 3 Region: 78-181
Classification Level Classification E-value
Superfamily Translational machinery components 3.27e-25
Family ERF1/Dom34 middle domain-like 0.00000691
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000041020   Gene: ENSMMUG00000032438   Transcript: ENSMMUT00000047982
Sequence length 322
Comment pep:known chromosome:MMUL_1:X:64368007:64369054:1 gene:ENSMMUG00000032438 transcript:ENSMMUT00000047982 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NCLSVLGAITSVQQRLKLYNKVPSNGLVVYCGTTVTEEGKEKKVNIDFEPFKPINTSLYL
CDNKFHTEALIALLSDYSKFGFIVIDGSGAVFGTLQGNTSLHKFIVDLPKKHGKGGQSSL
CFASLRMEKRYNYVWKVAELFISGDKVNVTGLVLAGSANFKTELSQSDIFDQKLQSIELS
TEVLSNVKFIQEKKLFDKISHDMGKYCFGIEDSLKALKMGAVETLIVFENLDNEICSSLT
KHRRGENSLTPEQEKDTSHFIDKETGWEHELIESIPLLEWFANNYKKCGATLEIVTDKSQ
EMSQFVKGFGRSAGILWYRVDF
Download sequence
Identical sequences ENSMMUP00000041020 9544.ENSMMUP00000041020 ENSMMUP00000041020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]