SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000041201 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000041201
Domain Number 1 Region: 28-111
Classification Level Classification E-value
Superfamily SWIB/MDM2 domain 0.000000000687
Family SWIB/MDM2 domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000041201   Gene: ENSMMUG00000032522   Transcript: ENSMMUT00000048163
Sequence length 150
Comment pep:known chromosome:MMUL_1:X:15659734:15660380:1 gene:ENSMMUG00000032522 transcript:ENSMMUT00000048163 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PFSTSSQCSTCDSACGFSPEYVQHIRSKQPPLLKFLQAAGARRNAGCWSDQAVSRPLSSG
KATYDLQEQPVAILRCDGGLLGGLPGCQQFSMKDPSPVFDKLRKNLINSSPGSWPGYSQP
RPMEAMYRGKFQIQENKERRQFSHTVYLTT
Download sequence
Identical sequences ENSMMUP00000041201 9544.ENSMMUP00000041201 ENSMMUP00000041201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]